1H2V - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   STRUCTURE OF THE HUMAN NUCLEAR CAP-BINDING-COMPLEX (CBC)

Authors :   C. Mazza, A. Segref, I. W. Mattaj, S. Cusack

Date :   16 Aug 02 (Deposition) - 17 Oct 02 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym./Biol. Unit : C,Z

Keywords :   Cap-Binding-Complex, Rnp Domain, Mif4G Domain, Rna Maturation, Rna Export, Nuclear Protein, Rna-Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. Mazza, A. Segref, I. W. Mattaj, S. Cusack
Large-Scale Induced Fit Recognition Of An M(7)Gpppg Cap Analogue By The Human Nuclear Cap-Binding Complex
Embo J. V. 21 5548 2002
PubMed-ID: 12374755 | Reference-DOI: 10.1093/EMBOJ/CDF538
(for further references see the PDB file header)

Molecule 1 - 80 KDA NUCLEAR CAP BINDING PROTEIN
	Chains	:	C
	Engineered	:	YES
	Expression System	:	TRICHOPLUSIA NI
	Expression System Cell Line	:	HIGH FIVE
	Expression System Taxid	:	7111
	Expression System Vector Type	:	BACULOVIRUS
	Fragment	:	MIF4G DOMAIN, RESIDUES 20-790
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	DELETION OF THE FIRST 19 RESIDUES IN N-TERMINAL, ENGINEERED MUTATION ALA 479 SER
	Synonym	:	NCBP 80 KDA SUBUNIT, CBP80

Molecule 2 - 20 KDA NUCLEAR CAP BINDING PROTEIN
	Chains	:	Z
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PRSETA
	Expression System Strain	:	BL21
	Expression System Taxid	:	511693
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CBP20, NCBP 20 KDA SUBUNIT, NCBP INTERACTING PROTEIN 1, NIP1

		1	2
Asymmetric/Biological Unit	:	C	Z

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1H2V)

(no "Site" information available for 1H2V)

(no "SS Bond" information available for 1H2V)

Asymmetric/Biological Unit

No.	Residues
1	Lys C:221	-	Pro C:222
2	Leu C:362	-	Pro C:363

(no "SAP(SNP)/Variant" information available for 1H2V)

Asymmetric/Biological Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RRM	PS50102	Eukaryotic RNA Recognition Motif (RRM) profile.	NCBP2_HUMAN	40-118	1	Z:40-118

Asymmetric/Biological Unit (24, 24)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000321256	1a	ENSE00001056985	chr3:196669468-196669297	172	NCBP2_HUMAN	1-26	26	0	-	-
1.3c	ENST00000321256	3c	ENSE00001786473	chr3:196666303-196666122	182	NCBP2_HUMAN	27-87	61	1	Z:33-87	55
1.3g	ENST00000321256	3g	ENSE00001618834	chr3:196664519-196664381	139	NCBP2_HUMAN	87-133	47	1	Z:87-125	39
1.3p	ENST00000321256	3p	ENSE00001929594	chr3:196663953-196662278	1676	NCBP2_HUMAN	134-156	23	0	-	-

2.1a	ENST00000375147	1a	ENSE00002154723	chr9:100395908-100396197	290	NCBP1_HUMAN	1-12	12	0	-	-
2.2	ENST00000375147	2	ENSE00001610908	chr9:100403076-100403164	89	NCBP1_HUMAN	12-41	30	1	C:29-41	13
2.3	ENST00000375147	3	ENSE00001626181	chr9:100403844-100403944	101	NCBP1_HUMAN	42-75	34	1	C:42-75	34
2.4	ENST00000375147	4	ENSE00001686031	chr9:100405486-100405642	157	NCBP1_HUMAN	75-127	53	1	C:75-127	53
2.5	ENST00000375147	5	ENSE00001730187	chr9:100407399-100407506	108	NCBP1_HUMAN	128-163	36	1	C:128-163	36
2.6	ENST00000375147	6	ENSE00001803534	chr9:100407893-100408014	122	NCBP1_HUMAN	164-204	41	1	C:164-204	41
2.7	ENST00000375147	7	ENSE00001693192	chr9:100409774-100409843	70	NCBP1_HUMAN	204-227	24	1	C:204-227	24
2.8	ENST00000375147	8	ENSE00001662271	chr9:100410290-100410505	216	NCBP1_HUMAN	228-299	72	1	C:228-299	72
2.9b	ENST00000375147	9b	ENSE00001610051	chr9:100412785-100412882	98	NCBP1_HUMAN	300-332	33	1	C:300-332	33
2.10	ENST00000375147	10	ENSE00001738969	chr9:100413592-100413655	64	NCBP1_HUMAN	332-353	22	1	C:332-353	22
2.11	ENST00000375147	11	ENSE00001767060	chr9:100416080-100416190	111	NCBP1_HUMAN	354-390	37	1	C:354-390	37
2.12	ENST00000375147	12	ENSE00001626418	chr9:100417162-100417226	65	NCBP1_HUMAN	391-412	22	1	C:391-412	22
2.13	ENST00000375147	13	ENSE00001803324	chr9:100417984-100418046	63	NCBP1_HUMAN	412-433	22	1	C:412-433	22
2.14	ENST00000375147	14	ENSE00001648128	chr9:100418293-100418367	75	NCBP1_HUMAN	433-458	26	1	C:433-458	26
2.15	ENST00000375147	15	ENSE00001763342	chr9:100420922-100421025	104	NCBP1_HUMAN	458-493	36	1	C:458-493	36
2.16	ENST00000375147	16	ENSE00001592843	chr9:100423228-100423350	123	NCBP1_HUMAN	493-534	42	1	C:493-526	34
2.17	ENST00000375147	17	ENSE00001800577	chr9:100424324-100424426	103	NCBP1_HUMAN	534-568	35	1	C:539-568	30
2.18	ENST00000375147	18	ENSE00001802313	chr9:100425236-100425329	94	NCBP1_HUMAN	568-599	32	1	C:568-599	32
2.19	ENST00000375147	19	ENSE00001714911	chr9:100426622-100426725	104	NCBP1_HUMAN	600-634	35	1	C:600-634	35
2.20b	ENST00000375147	20b	ENSE00001728703	chr9:100429045-100429159	115	NCBP1_HUMAN	634-672	39	1	C:634-663	30
2.21	ENST00000375147	21	ENSE00000926499	chr9:100431128-100431256	129	NCBP1_HUMAN	673-715	43	1	C:692-715	24
2.22a	ENST00000375147	22a	ENSE00000926500	chr9:100431875-100431988	114	NCBP1_HUMAN	716-753	38	1	C:716-753	38
2.23a	ENST00000375147	23a	ENSE00001465914	chr9:100433368-100436030	2663	NCBP1_HUMAN	754-790	37	1	C:754-790	37

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain C from PDB  Type:PROTEIN  Length:722
 aligned with NCBP1_HUMAN | Q09161 from UniProtKB/Swiss-Prot  Length:790

    Alignment length:762
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668       678       688       698       708       718       728       738       748       758       768       778       788  
          NCBP1_HUMAN    29 DHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANNYNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEEDVPQVRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFANTESYLKRRQKTHVPMLQVWTADKPHPQEEYLDCLWAQIQKLKKDRWQERHILRPYLAFDSILCEALQHNLPPFTPPPHTEDSVYPMPRVIFRMFDYTDDPEGPVMPGSHSVERFVIEENLHCIIKSHWKERKTCAAQLVSYPGKNKIPLNYHIVEVIFAELFQLPAPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLYMRLDTMNTTCVDRFINWFSHHLSNFQFRWSWEDWSDCLSQDPESPKPKFVREVLEKCMRLSYHQRILDIVPPTFSALCPANPTCIYKYGDESSNSLPGHSVALCLAVAFKSKATNDEIFSILKDVPNPNQDDDDDEGFSFNPLKIEVFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAESDEGKLHVLRVMFEVWRNHPQMIAVLVDKMIRTQIVDCAAVANWIFSSELSRDFTRLFVWEILHSTIRKMNKHVLKIQKELEEAKEKLARQHKRRSDDDDRSSDRKDGVLEEQIERLQEKVESAQSEQKNLFLVIFQRFIMILTEHLVRCETDGTSVLTPWYKNCIERLQQIFLQHHQIIQQYMVTLENLLFTAELDPHILAVFQQFCALQA 790
               SCOP domains d1h2vc1 C:29-290 CBP80, 80KDa nuclear cap-binding protein                                                                                                                                                                                                             d1h2vc2 C:291-480 CBP80, 80KDa nuclear cap-binding protein                                                                                                                                    d1h2vc3 C:481-790 CBP80, 80KDa nuclear cap-bin            ding protein                                                                                                                                                                                                                                                 SCOP domains
               CATH domains 1h2vC01 C:29-288  [code=1.25.40.180, no name defined]                                                                                                                                                                                                               --------------------1h2vC02 C:309-478  [code=1.25.40.180, no name defined]                                                                                                                    ----------1h2vC03 C:489-788  [code=1.25.40.180,             no name defined]                                                                                                                                                                                                                                          -- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhh...........hhhhhhhhhhhhhhhh........hhhhhhh...hhhhh...........................hhhhh..........hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh.......hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh......hhhhhhhhh.....hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh...................hhhhhhhhhhhhhh..hhhhhhhhhhhh..------------.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.----------------------------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhh.....hhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 2 (1) Exon 2.2     Exon 2.3  PDB: C:42-75            ----------------------------------------------------Exon 2.5  PDB: C:128-163            Exon 2.6  PDB: C:164-204 UniProt: 164-204-----------------------Exon 2.8  PDB: C:228-299 UniProt: 228-299                               --------------------------------Exon 2.10             Exon 2.11  PDB: C:354-390            Exon 2.12             --------------------Exon 2.14  PDB: C:433-458 ----------------------------------Exon 2.16  PDB: C:493-526 UniProt: 493-534---------------------------------Exon 2.18  PDB: C:568-599       Exon 2.19  PDB: C:600-634          --------------------------------------Exon 2.21  PDB: C:692-715 UniProt: 673-715 Exon 2.22a  PDB: C:716-753            Exon 2.23a  PDB: C:754-790            Transcript 2 (1)
           Transcript 2 (2) ----------------------------------------------Exon 2.4  PDB: C:75-127 UniProt: 75-127              ----------------------------------------------------------------------------Exon 2.7  PDB: C:204-227------------------------------------------------------------------------Exon 2.9b  PDB: C:300-332        -------------------------------------------------------------------------------Exon 2.13             ------------------------Exon 2.15  PDB: C:458-493           ----------------------------------------Exon 2.17  PDB: C:539-568          -----------------------------------------------------------------Exon 2.20b  PDB: C:634-663 [INCOMPLETE]---------------------------------------------------------------------------------------------------------------------- Transcript 2 (2)
                 1h2v C  29 DHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANNYNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEEDVPQVRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFANTESYLKRRQKTHVPMLQVWTADKPHPQEEYLDCLWAQIQKLKKDRWQERHILRPYLAFDSILCEALQHNLPPFTPPPHTEDSVYPMPRVIFRMFDYTDDPEGPVMPGSHSVERFVIEENLHCIIKSHWKERKTCAAQLVSYPGKNKIPLNYHIVEVIFAELFQLPAPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLYMRLDTMNTTCVDRFINWFSHHLSNFQFRWSWEDWSDCLSQDPESPKPKFVREVLEKCMRLSYHQRILDIVPPTFSALCPSNPTCIYKYGDESSNSLPGHSVALCLAVAFKSKATNDEIFSILKDVPN------------FNPLKIEVFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAESDEGKLHVLRVMFEVWRNHPQMIAVLVDKMIRTQIVDCAAVANWIFSSELSRDFTRLFVWEILHSTIRKMNKHVLKIQKELEEAK----------------------------IERLQEKVESAQSEQKNLFLVIFQRFIMILTEHLVRCETDGTSVLTPWYKNCIERLQQIFLQHHQIIQQYMVTLENLLFTAELDPHILAVFQQFCALQA 790
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       | -         -|      548       558       568       578       588       598       608       618       628       638       648       658    |    -         -         -   |   698       708       718       728       738       748       758       768       778       788  
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           526          539                                                                                                                         663                          692

Chain Z from PDB  Type:PROTEIN  Length:93
 aligned with NCBP2_HUMAN | P52298 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:93
                                    42        52        62        72        82        92       102       112       122   
          NCBP2_HUMAN    33 EKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQY 125
               SCOP domains d1h2vz_ Z: CBP20, 20KDa nuclear cap-binding protein                                           SCOP domains
               CATH domains 1h2vZ00 Z:33-125  [code=3.30.70.330, no name defined]                                         CATH domains
               Pfam domains --------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeee......hhhhhhhhhhhhh.eeeeeeee......eeeeeeeee.hhhhhhhhhhhh...ee..ee.eeeee......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------RRM  PDB: Z:40-118 UniProt: 40-118                                             ------- PROSITE
           Transcript 1 (1) Exon 1.3c  PDB: Z:33-87 UniProt: 27-87 [INCOMPLETE]    -------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------Exon 1.3g  PDB: Z:87-125 [INCOMPLETE]   Transcript 1 (2)
                 1h2v Z  33 EKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQY 125
                                    42        52        62        72        82        92       102       112       122

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: alpha-alpha superhelix (690)

Superfamily: ARM repeat (317)

Family: MIF4G domain-like (17)

Protein domain: CBP80, 80KDa nuclear cap-binding protein (6)

Human (Homo sapiens) [TaxId: 9606] (6)

1a	d1h2vc1	C:29-290
1b	d1h2vc2	C:291-480
1c	d1h2vc3	C:481-790

Class: Alpha and beta proteins (a+b) (23004)

Fold: Ferredoxin-like (1795)

Superfamily: RNA-binding domain, RBD (289)

Family: Canonical RBD (214)

Protein domain: CBP20, 20KDa nuclear cap-binding protein (7)

Human (Homo sapiens) [TaxId: 9606] (7)

d1h2vz_

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Alpha-Beta Plaits (1688)

Homologous Superfamily: [code=3.30.70.330, no name defined] (307)

Human (Homo sapiens) (81)

1h2vZ00

Z:33-125

Class: Mainly Alpha (13335)

Architecture: Alpha Horseshoe (399)

Topology: Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat (320)

Homologous Superfamily: [code=1.25.40.180, no name defined] (12)

Human (Homo sapiens) (10)

2a	1h2vC01	C:29-288
2b	1h2vC03	C:489-788
2c	1h2vC02	C:309-478

(no "Pfam Domain" information available for 1H2V)

Asymmetric/Biological Unit(hide GO term definitions)

Chain C (NCBP1_HUMAN | Q09161)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0000339	RNA cap binding	Interacting selectively and non-covalently with a 7-methylguanosine (m7G) group or derivative located at the 5' end of an RNA molecule.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006370	7-methylguanosine mRNA capping	Addition of the 7-methylguanosine cap to the 5' end of a nascent messenger RNA transcript.
	GO:0006405	RNA export from nucleus	The directed movement of RNA from the nucleus to the cytoplasm.
	GO:0016070	RNA metabolic process	The cellular chemical reactions and pathways involving RNA, ribonucleic acid, one of the two main type of nucleic acid, consisting of a long, unbranched macromolecule formed from ribonucleotides joined in 3',5'-phosphodiester linkage.
	GO:0008380	RNA splicing	The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
	GO:0008543	fibroblast growth factor receptor signaling pathway	The series of molecular signals generated as a consequence of a fibroblast growth factor receptor binding to one of its physiological ligands.
	GO:0010467	gene expression	The process in which a gene's sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0031047	gene silencing by RNA	Any process in which RNA molecules inactivate expression of target genes.
	GO:0008334	histone mRNA metabolic process	The chemical reactions and pathways involving an mRNA encoding a histone.
	GO:0031124	mRNA 3'-end processing	Any process involved in forming the mature 3' end of an mRNA molecule.
	GO:0045292	mRNA cis splicing, via spliceosome	The joining together, after removal of an intervening sequence composed of one or more introns, of two segments of the same RNA molecule via spliceosomal catalysis to produce an mRNA composed only of exon sequences that all came from the same primary transcript.
	GO:0006406	mRNA export from nucleus	The directed movement of mRNA from the nucleus to the cytoplasm.
	GO:0006397	mRNA processing	Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
	GO:0000398	mRNA splicing, via spliceosome	The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
	GO:0051028	mRNA transport	The directed movement of mRNA, messenger ribonucleic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0051168	nuclear export	The directed movement of substances out of the nucleus.
	GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	The nonsense-mediated decay pathway for nuclear-transcribed mRNAs degrades mRNAs in which an amino-acid codon has changed to a nonsense codon; this prevents the translation of such mRNAs into truncated, and potentially harmful, proteins.
	GO:0030307	positive regulation of cell growth	Any process that activates or increases the frequency, rate, extent or direction of cell growth.
	GO:0031442	positive regulation of mRNA 3'-end processing	Any process that activates or increases the frequency, rate or extent of mRNA 3'-end processing.
	GO:0098789	pre-mRNA cleavage required for polyadenylation	The targeted, endonucleolytic cleavage of a pre-mRNA, required for polyadenylation of the 3' end. This cleavage is directed by binding sites near the 3' end of the mRNA and leaves a 3' hydoxyl end which then becomes a target for adenylation.
	GO:1900363	regulation of mRNA polyadenylation	Any process that modulates the frequency, rate or extent of mRNA polyadenylation.
	GO:0006417	regulation of translation	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.
	GO:0006446	regulation of translational initiation	Any process that modulates the frequency, rate or extent of translational initiation.
	GO:0042795	snRNA transcription from RNA polymerase II promoter	The synthesis of small nuclear RNA (snRNA) from a DNA template by RNA Polymerase II (Pol II), originating at a Pol II promoter.
	GO:0006369	termination of RNA polymerase II transcription	The process in which the synthesis of an RNA molecule by RNA polymerase II using a DNA template is completed.
	GO:0006368	transcription elongation from RNA polymerase II promoter	The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase II promoter by the addition of ribonucleotides catalyzed by RNA polymerase II.
	GO:0006366	transcription from RNA polymerase II promoter	The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0034518	RNA cap binding complex	Any protein complex that binds to a specialized RNA cap structure at any time in the lifetime of the RNA.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005845	mRNA cap binding complex	Any protein complex that binds to an mRNA cap at any time in the lifetime of the mRNA.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005846	nuclear cap binding complex	A conserved heterodimeric protein complex that binds to the 5' terminal cap structure m7G(5')ppp(5')N of nascent eukaryotic RNA polymerase II transcripts such as pre-mRNA and U snRNA. The consists of proteins known as CBP20 and CBP80, binds to cap structures in the nucleus, and is involved in pre-mRNA splicing, 3'-end formation, and RNA nuclear export.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain Z (NCBP2_HUMAN | P52298)

molecular function
	GO:0000340	RNA 7-methylguanosine cap binding	Interacting selectively and non-covalently with the 7-methylguanosine group added cotranscriptionally to the 5' end of RNA molecules transcribed by polymerase II.
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0000339	RNA cap binding	Interacting selectively and non-covalently with a 7-methylguanosine (m7G) group or derivative located at the 5' end of an RNA molecule.
	GO:0003729	mRNA binding	Interacting selectively and non-covalently with messenger RNA (mRNA), an intermediate molecule between DNA and protein. mRNA includes UTR and coding sequences, but does not contain introns.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0017069	snRNA binding	Interacting selectively and non-covalently with a small nuclear RNA (snRNA).
biological process
	GO:0006370	7-methylguanosine mRNA capping	Addition of the 7-methylguanosine cap to the 5' end of a nascent messenger RNA transcript.
	GO:0006405	RNA export from nucleus	The directed movement of RNA from the nucleus to the cytoplasm.
	GO:0008380	RNA splicing	The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
	GO:0008543	fibroblast growth factor receptor signaling pathway	The series of molecular signals generated as a consequence of a fibroblast growth factor receptor binding to one of its physiological ligands.
	GO:0010467	gene expression	The process in which a gene's sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0031047	gene silencing by RNA	Any process in which RNA molecules inactivate expression of target genes.
	GO:0008334	histone mRNA metabolic process	The chemical reactions and pathways involving an mRNA encoding a histone.
	GO:0031124	mRNA 3'-end processing	Any process involved in forming the mature 3' end of an mRNA molecule.
	GO:0045292	mRNA cis splicing, via spliceosome	The joining together, after removal of an intervening sequence composed of one or more introns, of two segments of the same RNA molecule via spliceosomal catalysis to produce an mRNA composed only of exon sequences that all came from the same primary transcript.
	GO:0006406	mRNA export from nucleus	The directed movement of mRNA from the nucleus to the cytoplasm.
	GO:0006397	mRNA processing	Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
	GO:0000398	mRNA splicing, via spliceosome	The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
	GO:0051028	mRNA transport	The directed movement of mRNA, messenger ribonucleic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0051168	nuclear export	The directed movement of substances out of the nucleus.
	GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	The nonsense-mediated decay pathway for nuclear-transcribed mRNAs degrades mRNAs in which an amino-acid codon has changed to a nonsense codon; this prevents the translation of such mRNAs into truncated, and potentially harmful, proteins.
	GO:0046833	positive regulation of RNA export from nucleus	Any process that activates or increases the frequency, rate or extent of directed movement of RNA from the nucleus into the cytoplasm.
	GO:0031442	positive regulation of mRNA 3'-end processing	Any process that activates or increases the frequency, rate or extent of mRNA 3'-end processing.
	GO:0098789	pre-mRNA cleavage required for polyadenylation	The targeted, endonucleolytic cleavage of a pre-mRNA, required for polyadenylation of the 3' end. This cleavage is directed by binding sites near the 3' end of the mRNA and leaves a 3' hydoxyl end which then becomes a target for adenylation.
	GO:1900363	regulation of mRNA polyadenylation	Any process that modulates the frequency, rate or extent of mRNA polyadenylation.
	GO:0006417	regulation of translation	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.
	GO:0006446	regulation of translational initiation	Any process that modulates the frequency, rate or extent of translational initiation.
	GO:0006408	snRNA export from nucleus	The directed movement of snRNA from the nucleus to the cytoplasm.
	GO:0042795	snRNA transcription from RNA polymerase II promoter	The synthesis of small nuclear RNA (snRNA) from a DNA template by RNA Polymerase II (Pol II), originating at a Pol II promoter.
	GO:0006369	termination of RNA polymerase II transcription	The process in which the synthesis of an RNA molecule by RNA polymerase II using a DNA template is completed.
	GO:0006368	transcription elongation from RNA polymerase II promoter	The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase II promoter by the addition of ribonucleotides catalyzed by RNA polymerase II.
	GO:0006366	transcription from RNA polymerase II promoter	The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005845	mRNA cap binding complex	Any protein complex that binds to an mRNA cap at any time in the lifetime of the mRNA.
	GO:0005846	nuclear cap binding complex	A conserved heterodimeric protein complex that binds to the 5' terminal cap structure m7G(5')ppp(5')N of nascent eukaryotic RNA polymerase II transcripts such as pre-mRNA and U snRNA. The consists of proteins known as CBP20 and CBP80, binds to cap structures in the nucleus, and is involved in pre-mRNA splicing, 3'-end formation, and RNA nuclear export.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1h2v)

	Sites
(no "Sites" information available for 1h2v)

	Cis Peptide Bonds
		Leu C:362 - Pro C:363	[ RasMol ]
		Lys C:221 - Pro C:222	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1h2v
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	NCBP1_HUMAN \| Q09161
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	NCBP2_HUMAN \| P52298
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	NCBP1_HUMAN \| Q09161
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	NCBP2_HUMAN \| P52298
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	NCBP1_HUMAN \| Q09161	:	1h2t 1h2u 1h6k 1n52 1n54 3fex 3fey
	NCBP2_HUMAN \| P52298	:	1h2t 1h2u 1h6k 1n52 1n54 3fex 3fey

1h2t	STRUCTURE OF THE HUMAN NUCLEAR CAP-BINDING- COMPLEX (CBC) IN COMPLEX WIHT A CAP ANALOGUE M7GPPPG
1h2u	STRUCTURE OF THE HUMAN NUCLEAR CAP-BINDING- COMPLEX (CBC) IN COMPLEX WIHT A CAP ANALOGUE M7GPPPG
1h6k	NUCLEAR CAP BINDING COMPLEX

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (24, 24)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (2, 4)

Pfam Domains (0, 0)

Gene Ontology (46, 80)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File