1GNK - JenaLib

Title :   GLNK, A SIGNAL PROTEIN FROM E. COLI

Authors :   Y. Xu, E. Cheah, P. D. Carr, W. C. Vanheeswijk, H. V. Westerhoff, S. G. Vas D. L. Ollis

Date :   14 Jul 98 (Deposition) - 23 Jul 99 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (3x)
Biol. Unit 2: B  (3x)

Keywords :   Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Xu, E. Cheah, P. D. Carr, W. C. Van Heeswijk, H. V. Westerhoff, S. G. Vasudevan, D. L. Ollis
Glnk, A Pii-Homologue: Structure Reveals Atp Binding Site And Indicates How The T-Loops May Be Involved In Molecular Recognition.
J. Mol. Biol. V. 282 149 1998
PubMed-ID: 9733647 | Reference-DOI: 10.1006/JMBI.1998.1979

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 5)

Asymmetric Unit (3, 5)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PII_GLNB_DOM	PS51343	P-II protein family profile.	GLNK_ECOLI	1-112	2	A:1-112 B:1-112
2	PII_GLNB_UMP	PS00496	P-II protein uridylation site.	GLNK_ECOLI	46-51	1	B:46-51
3	PII_GLNB_CTER	PS00638	P-II protein C-terminal region signature.	GLNK_ECOLI	83-96	2	A:83-96 B:83-96

Biological Unit 1 (2, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PII_GLNB_DOM	PS51343	P-II protein family profile.	GLNK_ECOLI	1-112	3	A:1-112 -
2	PII_GLNB_UMP	PS00496	P-II protein uridylation site.	GLNK_ECOLI	46-51	0	-
3	PII_GLNB_CTER	PS00638	P-II protein C-terminal region signature.	GLNK_ECOLI	83-96	3	A:83-96 -

Biological Unit 2 (3, 9)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PII_GLNB_DOM	PS51343	P-II protein family profile.	GLNK_ECOLI	1-112	3	- B:1-112
2	PII_GLNB_UMP	PS00496	P-II protein uridylation site.	GLNK_ECOLI	46-51	3	B:46-51
3	PII_GLNB_CTER	PS00638	P-II protein C-terminal region signature.	GLNK_ECOLI	83-96	3	- B:83-96

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:98
 aligned with GLNK_ECOLI | P0AC55 from UniProtKB/Swiss-Prot  Length:112

    Alignment length:112
                                    10        20        30        40        50        60        70        80        90       100       110  
           GLNK_ECOLI     1 MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL 112
               SCOP domains d1gnka_ A: PII-homolog GlnK                                                                                      SCOP domains
               CATH domains 1gnkA00 A:1-112  [code=3.30.70.120, no               name defined]                                               CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.hhhhhhhhhhhhhh.....eeeeeeeee.--------------.eeeeeeeeeeee.hhhhhhhhhhhhhhh........eeeeee............hhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) PII_GLNB_DOM  PDB: A:1-112 UniProt: 1-112                                                                        PROSITE (1)
                PROSITE (2) ---------------------------------------------PII_GL-------------------------------PII_GLNB_CTER ---------------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------- Transcript
                 1gnk A   1 MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGR--------------VNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL 112
                                    10        20        30       | -         -  |     60        70        80        90       100       110  
                                                                38             53

Chain B from PDB  Type:PROTEIN  Length:112
 aligned with GLNK_ECOLI | P0AC55 from UniProtKB/Swiss-Prot  Length:112

    Alignment length:112
                                    10        20        30        40        50        60        70        80        90       100       110  
           GLNK_ECOLI     1 MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL 112
               SCOP domains d1gnkb_ B: PII-homolog GlnK                                                                                      SCOP domains
               CATH domains 1gnkB00 B:1-112  [code=3.30.70.120, no name defined]                                                             CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.hhhhhhhhhhhhhh.....eeeeeee...........hhh......eeeeeeeeee..hhhhhhhhhhhhhh.......eeeeeee............hhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) PII_GLNB_DOM  PDB: B:1-112 UniProt: 1-112                                                                        PROSITE (1)
                PROSITE (2) ---------------------------------------------PII_GL-------------------------------PII_GLNB_CTER ---------------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------- Transcript
                 1gnk B   1 MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL 112
                                    10        20        30        40        50        60        70        80        90       100       110

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (9, 9)

Asymmetric Unit(hide GO term definitions)

Chain A,B (GLNK_ECOLI | P0AC55)

molecular function
	GO:0030234	enzyme regulator activity	Binds to and modulates the activity of an enzyme.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0045848	positive regulation of nitrogen utilization	Any process that activates or increases the frequency, rate or extent of nitrogen utilization.
	GO:0050790	regulation of catalytic activity	Any process that modulates the activity of an enzyme.
	GO:0006808	regulation of nitrogen utilization	Any process that modulates the frequency, rate or extent of nitrogen utilization.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1gnk)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1gnk
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GLNK_ECOLI \| P0AC55
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description