|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1GL8) |
Sites (0, 0)| (no "Site" information available for 1GL8) |
SS Bonds (1, 1)
NMR Structure
|
||||||||
Cis Peptide Bonds (1, 25)
NMR Structure
|
||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1GL8) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1GL8) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:104 aligned with TRXM_SPIOL | P07591 from UniProtKB/Swiss-Prot Length:181 Alignment length:104 85 95 105 115 125 135 145 155 165 175 TRXM_SPIOL 76 VQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYL 179 SCOP domains d1gl8a_ A: Thioredoxin SCOP domains CATH domains 1gl8A00 A:14-117 Glutaredoxin CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------THIOREDOXIN_1 ----------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------- Transcript 1gl8 A 14 VQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYL 117 23 33 43 53 63 73 83 93 103 113
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1GL8) |
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (TRXM_SPIOL | P07591)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|