|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1FB6) |
Sites (0, 0)| (no "Site" information available for 1FB6) |
SS Bonds (2, 2)
Asymmetric Unit
|
||||||||||||
Cis Peptide Bonds (2, 2)
Asymmetric Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1FB6) |
PROSITE Motifs (1, 2)
Asymmetric Unit (1, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1FB6) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:104 aligned with TRXM_SPIOL | P07591 from UniProtKB/Swiss-Prot Length:181 Alignment length:104 85 95 105 115 125 135 145 155 165 175 TRXM_SPIOL 76 VQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYL 179 SCOP domains d1fb6a_ A: Thioredoxin SCOP domains CATH domains 1fb6A00 A:9-112 Glutaredoxin CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------THIOREDOXIN_1 ----------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------- Transcript 1fb6 A 9 VQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYL 112 18 28 38 48 58 68 78 88 98 108 Chain B from PDB Type:PROTEIN Length:104 aligned with TRXM_SPIOL | P07591 from UniProtKB/Swiss-Prot Length:181 Alignment length:104 85 95 105 115 125 135 145 155 165 175 TRXM_SPIOL 76 VQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYL 179 SCOP domains d1fb6b_ B: Thioredoxin SCOP domains CATH domains 1fb6B00 B:9-112 Glutaredoxin CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------THIOREDOXIN_1 ----------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------- Transcript 1fb6 B 9 VQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYL 112 18 28 38 48 58 68 78 88 98 108
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1FB6) |
Gene Ontology (7, 7)|
Asymmetric Unit(hide GO term definitions) Chain A,B (TRXM_SPIOL | P07591)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|