Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  INNER LIPOYL DOMAIN FROM HUMAN PYRUVATE DEHYDROGENASE (PDH) COMPLEX, NMR, 1 STRUCTURE
 
Authors :  M. J. Howard, C. Fuller, R. W. Broadhurst, J. Quinn, S. J. Yeaman, R. N. Perham
Date :  21 Feb 97  (Deposition) - 04 Sep 97  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A
Keywords :  Transferase, Acyltransferase Dihydrolipoamide, Subunit, Unlipoylated (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. J. Howard, C. Fuller, R. W. Broadhurst, R. N. Perham, J. G. Tang, J. Quinn, A. G. Diamond, S. J. Yeaman
Three-Dimensional Structure Of The Major Autoantigen In Primary Biliary Cirrhosis.
Gastroenterology V. 115 139 1998
PubMed-ID: 9649469
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - DIHYDROLIPOAMIDE ACETYLTRANSFERASE (E2P)
    ChainsA
    EC Number2.3.1.12
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidHLIP
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentLIPOYL DOMAIN
    OrganLIVER
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsDIHYDROLIPOAMIDE ACETYLTRANSFERASE SUBUNIT OF THE PYRUVATE DEHYDROGENASE (PDH) MULTIENZYME COMPLEX (UNLIPOYLATED DOMAIN)
    Other Details - SourceEXPRESSED AS A GST FUSION PROTEIN

 Structural Features

(-) Chains, Units

  
NMR Structure 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1FYC)

(-) Sites  (0, 0)

(no "Site" information available for 1FYC)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1FYC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1FYC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 1)

NMR Structure (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_047414D313VODP2_HUMANPolymorphism11553592AD104V

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 2)

NMR Structure (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BIOTINYL_LIPOYLPS50968 Biotinyl/lipoyl domain profile.ODP2_HUMAN91-167
218-294
  1-
A:9-85
2LIPOYLPS00189 2-oxo acid dehydrogenases acyltransferase component lipoyl binding site.ODP2_HUMAN116-145
243-272
  1-
A:34-63

(-) Exons   (3, 3)

NMR Structure (3, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002803461aENSE00001130691chr11:111895538-111896475938ODP2_HUMAN1-93930--
1.2bENST000002803462bENSE00000996256chr11:111896922-111897023102ODP2_HUMAN94-127340--
1.3bENST000002803463bENSE00001105302chr11:111899239-111899363125ODP2_HUMAN128-169420--
1.4ENST000002803464ENSE00001128003chr11:111899516-111899669154ODP2_HUMAN169-220521A:1-1111
1.5aENST000002803465aENSE00001127996chr11:111904128-111904254127ODP2_HUMAN221-263431A:12-5443
1.6ENST000002803466ENSE00001127990chr11:111907997-111908184188ODP2_HUMAN263-325631A:54-10653
1.7aENST000002803467aENSE00001127984chr11:111909968-111910121154ODP2_HUMAN326-377520--
1.8ENST000002803468ENSE00001127976chr11:111914190-11191425768ODP2_HUMAN377-399230--
1.9ENST000002803469ENSE00001127968chr11:111915862-11191595493ODP2_HUMAN400-430310--
1.10ENST0000028034610ENSE00001127959chr11:111916587-111916694108ODP2_HUMAN431-466360--
1.11ENST0000028034611ENSE00000996257chr11:111921958-111922073116ODP2_HUMAN467-505390--
1.12aENST0000028034612aENSE00000996239chr11:111930627-111930789163ODP2_HUMAN505-559550--
1.13aENST0000028034613aENSE00000996255chr11:111931762-111931898137ODP2_HUMAN560-605460--
1.14dENST0000028034614dENSE00001514061chr11:111933130-1119351141985ODP2_HUMAN605-647430--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:106
 aligned with ODP2_HUMAN | P10515 from UniProtKB/Swiss-Prot  Length:647

    Alignment length:106
                                   219       229       239       249       259       269       279       289       299       309      
           ODP2_HUMAN   210 APGSSYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLK 315
               SCOP domains d1fyca_ A: Lipoyl domain of dihydrolipoamide acetyltransferase                                             SCOP domains
               CATH domains 1fycA00 A:1-106  [code=2.40.50.100, no name defined]                                                       CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeee...........eeeee....eeeee..eeeeeeee...eeeeee..eeeeeee.....eeee....eeeeee..................... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------V-- SAPs(SNPs)
                PROSITE (1) --------BIOTINYL_LIPOYL  PDB: A:9-85 UniProt: 218-294                                --------------------- PROSITE (1)
                PROSITE (2) ---------------------------------LIPOYL  PDB: A:34-63          ------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.4   Exon 1.5a  PDB: A:12-54 UniProt: 221-263   ---------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------Exon 1.6  PDB: A:54-106 UniProt: 263-325 [INCOMPLETE] Transcript 1 (2)
                 1fyc A   1 GSNMSYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLK 106
                                    10        20        30        40        50        60        70        80        90       100      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1FYC)

(-) Gene Ontology  (19, 19)

NMR Structure(hide GO term definitions)
Chain A   (ODP2_HUMAN | P10515)
molecular function
    GO:0004742    dihydrolipoyllysine-residue acetyltransferase activity    Catalysis of the reaction: acetyl-CoA + dihydrolipoamide = CoA + S-acetyldihydrolipoamide.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0034604    pyruvate dehydrogenase (NAD+) activity    Catalysis of the reaction: pyruvate + CoA + NAD+ = acetyl-CoA + CO2 + NADH.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016746    transferase activity, transferring acyl groups    Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
biological process
    GO:0006086    acetyl-CoA biosynthetic process from pyruvate    The chemical reactions and pathways resulting in the formation of acetyl-CoA from pyruvate.
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0006006    glucose metabolic process    The chemical reactions and pathways involving glucose, the aldohexose gluco-hexose. D-glucose is dextrorotatory and is sometimes known as dextrose; it is an important source of energy for living organisms and is found free as well as combined in homo- and hetero-oligosaccharides and polysaccharides.
    GO:0046487    glyoxylate metabolic process    The chemical reactions and pathways involving glyoxylate, the anion of glyoxylic acid, HOC-COOH.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0006090    pyruvate metabolic process    The chemical reactions and pathways involving pyruvate, 2-oxopropanoate.
    GO:0010510    regulation of acetyl-CoA biosynthetic process from pyruvate    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of acetyl-CoA from pyruvate.
    GO:0030431    sleep    Any process in which an organism enters and maintains a periodic, readily reversible state of reduced awareness and metabolic activity. Usually accompanied by physical relaxation, the onset of sleep in humans and other mammals is marked by a change in the electrical activity of the brain.
    GO:0006099    tricarboxylic acid cycle    A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.
cellular component
    GO:0005759    mitochondrial matrix    The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
    GO:0005967    mitochondrial pyruvate dehydrogenase complex    Complex that carries out the oxidative decarboxylation of pyruvate to form acetyl-CoA in eukaryotes; includes subunits possessing three catalytic activities: pyruvate dehydrogenase (E1), dihydrolipoamide S-acetyltransferase (E2), and dihydrolipoamide dehydrogenase (E3). The This Eukaryotic form usually contains more subunits than its bacterial counterpart; for example, one known complex contains 30 E1 dimers, 60 E2 monomers, and 6 E3 dimers as well as a few copies of pyruvate dehydrogenase kinase and pyruvate dehydrogenase phosphatase.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0043209    myelin sheath    An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
    GO:0045254    pyruvate dehydrogenase complex    Complex that carries out the oxidative decarboxylation of pyruvate to form acetyl-CoA; comprises subunits possessing three catalytic activities: pyruvate dehydrogenase (E1), dihydrolipoamide S-acetyltransferase (E2), and dihydrolipoamide dehydrogenase (E3).

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1fyc)
 
  Sites
(no "Sites" information available for 1fyc)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1fyc)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1fyc
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ODP2_HUMAN | P10515
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.3.1.12
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ODP2_HUMAN | P10515
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ODP2_HUMAN | P105151y8n 1y8o 1y8p 2dne 2pnr 2q8i 3b8k 3crk 3crl

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1FYC)