1EM2 - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   STAR-RELATED LIPID TRANSPORT DOMAIN OF MLN64

Authors :   Y. Tsujishita, J. H. Hurley

Date :   14 Mar 00 (Deposition) - 02 May 00 (Release) - 11 Aug 10 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym./Biol. Unit : A

Keywords :   Beta Barrel, Lipid Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Tsujishita, J. H. Hurley
Structure And Lipid Transport Mechanism Of A Star-Related Domain.
Nat. Struct. Biol. V. 7 408 2000
PubMed-ID: 10802740 | Reference-DOI: 10.1038/75192

Molecule 1 - MLN64 PROTEIN
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET22B
	Expression System Taxid	:	562
	Expression System Vector	:	PLASMID
	Fragment	:	STAR-RELATED DOMAIN
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

		1
Asymmetric/Biological Unit	:	A

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 4)

No.	Name	Count	Type	Full Name
1	MSE	3	Mod. Amino Acid	SELENOMETHIONINE
2	TAR	1	Ligand/Ion	D(-)-TARTARIC ACID

Asymmetric Unit (1, 1)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	VAL A:341 , VAL A:342 , SER A:343 , ARG A:345 , SER A:395 , ASN A:396 , LEU A:414 , HOH A:632 , HOH A:636 , HOH A:651	BINDING SITE FOR RESIDUE TAR A 500

(no "SS Bond" information available for 1EM2)

(no "Cis Peptide Bond" information available for 1EM2)

(no "SAP(SNP)/Variant" information available for 1EM2)

Asymmetric/Biological Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	START	PS50848	START domain profile.	STAR3_HUMAN	248-443	1	A:248-443

Asymmetric/Biological Unit (8, 8)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000336308	1a	ENSE00001057947	chr17:37793318-37793484	167	STAR3_HUMAN	-	0	0	-	-
1.3a	ENST00000336308	3a	ENSE00002173531	chr17:37809734-37810003	270	STAR3_HUMAN	1-73	73	0	-	-
1.4b	ENST00000336308	4b	ENSE00001057951	chr17:37813261-37813338	78	STAR3_HUMAN	74-99	26	0	-	-
1.5b	ENST00000336308	5b	ENSE00001057946	chr17:37814028-37814105	78	STAR3_HUMAN	100-125	26	0	-	-
1.6b	ENST00000336308	6b	ENSE00001057941	chr17:37814226-37814279	54	STAR3_HUMAN	126-143	18	0	-	-
1.6d	ENST00000336308	6d	ENSE00001057943	chr17:37814658-37814775	118	STAR3_HUMAN	144-183	40	0	-	-
1.6g	ENST00000336308	6g	ENSE00001057948	chr17:37814975-37815073	99	STAR3_HUMAN	183-216	34	0	-	-
1.7b	ENST00000336308	7b	ENSE00001057950	chr17:37815304-37815359	56	STAR3_HUMAN	216-234	19	1	A:230-234	5
1.8a	ENST00000336308	8a	ENSE00001057944	chr17:37815714-37815806	93	STAR3_HUMAN	235-265	31	1	A:235-265	31
1.8c	ENST00000336308	8c	ENSE00000950629	chr17:37816464-37816526	63	STAR3_HUMAN	266-286	21	1	A:266-286	21
1.8d	ENST00000336308	8d	ENSE00000950630	chr17:37816684-37816779	96	STAR3_HUMAN	287-318	32	1	A:287-318	32
1.9	ENST00000336308	9	ENSE00000950631	chr17:37817063-37817142	80	STAR3_HUMAN	319-345	27	1	A:319-345	27
1.10	ENST00000336308	10	ENSE00000950632	chr17:37817234-37817338	105	STAR3_HUMAN	345-380	36	1	A:345-380	36
1.11a	ENST00000336308	11a	ENSE00001239164	chr17:37818504-37818597	94	STAR3_HUMAN	380-411	32	1	A:380-411	32
1.11e	ENST00000336308	11e	ENSE00001844235	chr17:37819057-37819737	681	STAR3_HUMAN	412-445	34	1	A:412-443	32

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:214
 aligned with STAR3_HUMAN | Q14849 from UniProtKB/Swiss-Prot  Length:445

    Alignment length:214
                                   239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439    
          STAR3_HUMAN   230 SFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGVVSPRDFVNVRRIERRRDRYLSSGIATSHSAKPPTHKYVRGENGPGGFIVLKSASNPRVCTFVWILNTDLKGRLPRYLIHQSLAATMFEFAFHLRQRISELGA 443
               SCOP domains d1em2a_ A: Lipid transport domain of Mln64                                                                                                                                                                             SCOP domains
               CATH domains 1em2A00 A:230-443  [code=3.30.530.20, no name defined]                                                                                                                                                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
     Sec.struct. author (1) ..hhhhhhhhhhhhhhhhhhhhhhhhhhhheeeee.....eeeeeee...eeeeeeeeee..hhhhhhhhh--hhhhhh--------------------------..........eeeeeeeeeeeeeeeeeeeeee............ee.ee..eeeeeee.......eeeeeee.ee.....hhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author (1)
     Sec.struct. author (2) ----------------------------------------------------------------------eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee------------------------------------------------------------------------------------------------------------- Sec.struct. author (2)
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------START  PDB: A:248-443 UniProt: 248-443                                                                                                                                                               PROSITE
           Transcript 1 (1) 1.7b Exon 1.8a  PDB: A:235-265      Exon 1.8c            Exon 1.8d  PDB: A:287-318       --------------------------Exon 1.10  PDB: A:345-380           -------------------------------Exon 1.11e  PDB: A:412-443       Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------Exon 1.9  PDB: A:319-345   ----------------------------------Exon 1.11a  PDB: A:380-411      -------------------------------- Transcript 1 (2)
                 1em2 A 230 SFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERmVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGVVSPRDFVNVRRIERRRDRYLSSGIATSHSAKPPTHKYVRGENGPGGmIVLKSASNPRVCTFVWILNTDLKGRLPRYLIHQSLAATmFEFAFHLRQRISELGA 443
                                   239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439    
                                                                                                       307-MSE                                                                          388-MSE                                427-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: TBP-like (289)

Superfamily: Bet v1-like (158)

Family: STAR domain (6)

Protein domain: Lipid transport domain of Mln64 (1)

Human (Homo sapiens) [TaxId: 9606] (1)

d1em2a_

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 (47)

Homologous Superfamily: [code=3.30.530.20, no name defined] (47)

Human (Homo sapiens) (6)

1em2A00

A:230-443

(no "Pfam Domain" information available for 1EM2)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (STAR3_HUMAN | Q14849)

molecular function
	GO:0015485	cholesterol binding	Interacting selectively and non-covalently with cholesterol (cholest-5-en-3-beta-ol); the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones.
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0008203	cholesterol metabolic process	The chemical reactions and pathways involving cholesterol, cholest-5-en-3 beta-ol, the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones. It is a component of the plasma membrane lipid bilayer and of plasma lipoproteins and can be found in all animal tissues.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0006869	lipid transport	The directed movement of lipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Lipids are compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
	GO:0006839	mitochondrial transport	Transport of substances into, out of or within a mitochondrion.
	GO:0006701	progesterone biosynthetic process	The chemical reactions and pathways resulting in the formation of progesterone, a steroid hormone produced in the ovary which prepares and maintains the uterus for pregnancy. Also found in plants.
	GO:0006694	steroid biosynthetic process	The chemical reactions and pathways resulting in the formation of steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus; includes de novo formation and steroid interconversion by modification.
	GO:0008202	steroid metabolic process	The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0031902	late endosome membrane	The lipid bilayer surrounding a late endosome.
	GO:0005765	lysosomal membrane	The lipid bilayer surrounding the lysosome and separating its contents from the cell cytoplasm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		TAR	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1em2)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1em2
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	STAR3_HUMAN \| Q14849
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	STAR3_HUMAN \| Q14849
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	STAR3_HUMAN \| Q14849	:	2i92 5i9j

(no "Related Entries Specified in the PDB File" available for 1EM2)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 4)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (8, 8)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (18, 18)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File