|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1EKS) |
Cis Peptide Bonds (2, 2)
Asymmetric Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1EKS) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1EKS) |
Exons (0, 0)| (no "Exon" information available for 1EKS) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:140 aligned with MOAC_ECOLI | P0A738 from UniProtKB/Swiss-Prot Length:161 Alignment length:142 24 34 44 54 64 74 84 94 104 114 124 134 144 154 MOAC_ECOLI 15 MVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSGGKSGDFK 156 SCOP domains d1eksa_ A: Molybdenum cofactor biosynthesis protein C, MoaC SCOP domains CATH domains 1eksA00 A:15-156 [code=3.30.70.640, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1eks A 15 MVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYAMCKAVQKDMVIGPVRLLAKS--KSGDFK 156 24 34 44 54 64 74 84 94 104 114 124 134 144 | |154 148 | 151
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1EKS) |
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A (MOAC_ECOLI | P0A738)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|