|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1EB0) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1EB0) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1EB0) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1EB0) |
Exons (0, 0)| (no "Exon" information available for 1EB0) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:143 aligned with UREE_SPOPA | P50049 from UniProtKB/Swiss-Prot Length:147 Alignment length:143 10 20 30 40 50 60 70 80 90 100 110 120 130 140 UREE_SPOPA 1 MLITKIVGHIDDYESSDKKVDWLEVEWEDLNKRILRKETENGTDIAIKLENSGTLRYGDVLYESDDTLIAIRTKLEKVYVIKPQTMQEMGKMAFEIGNRHTMCIIEDDEILVRYDKTLEKLIDEVGVSYEQSERRFKEPFKYR 143 SCOP domains d1eb0a1 A:1-74 Urease metallochaperone UreE, N-terminal domain d1eb0a2 A:75-143 Urease metallochaperone UreE, C-terminal domain SCOP domains CATH domains 1eb0A01 A:1-73 Urease metallochaperone UreE, N-terminal domain 1eb0A02 A:74-142 [code=3.30.70.790, no name defined] - CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1eb0 A 1 MVITKIVGHIDDLSHQIKKVDWLEVEWEDLNKRILRKETENGTDIAIKLENSGTLRYGDVLYESDDTLIAIRTKLEKVYVIKPQTMQEMGKMAFEIGNRHTMCIIEDDEILVRYDKTLEKLIDEVGVSYEQSERRFKEPFKYR 143 10 20 30 40 50 60 70 80 90 100 110 120 130 140
|
||||||||||||||||||||
SCOP Domains (2, 2)| Asymmetric Unit |
CATH Domains (2, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1EB0) |
Gene Ontology (8, 8)|
Asymmetric Unit(hide GO term definitions) Chain A (UREE_SPOPA | P50049)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|