1E50 - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Biological Unit 5 (Jmol Viewer)

Biological Unit 6 (Jmol Viewer)

Title :   AML1/CBF COMPLEX

Authors :   A. J. Warren, J. Bravo, R. L. Williams, T. H. Rabbits

Date :   13 Jul 00 (Deposition) - 12 Jul 01 (Release) - 09 Jun 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.60

Chains :   Asym. Unit : A,B,C,D,E,F,G,H,Q,R
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)
Biol. Unit 3: E,F  (1x)
Biol. Unit 4: G,H  (1x)
Biol. Unit 5: Q  (1x)
Biol. Unit 6: R  (1x)

Keywords :   Transcription Factor, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. J. Warren, J. Bravo, R. L. Williams, T. H. Rabbits
Structural Basis For The Heterodimeric Interaction Between The Acute Leukaemia-Associated Transcription Factors Aml1 And Cbfbeta
Embo J. V. 19 3004 2000
PubMed-ID: 10856244 | Reference-DOI: 10.1093/EMBOJ/19.12.3004

Molecule 1 - CORE-BINDING FACTOR ALPHA SUBUNIT
	Chains	:	A, C, E, G, Q, R
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PRSET
	Expression System Strain	:	DE3
	Expression System Taxid	:	562
	Expression System Variant	:	C41
	Expression System Vector Type	:	PLASMID
	Fragment	:	RUNT DOMAIN RESIDUES 50-183
	Gene	:	AML1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CBFA2/PEPBP2AB/RUNX1, AML1

Molecule 2 - CORE-BINDING FACTOR CBF-BETA
	Chains	:	B, D, F, H
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PRSET
	Expression System Strain	:	DE3
	Expression System Taxid	:	562
	Expression System Variant	:	C41
	Expression System Vector Type	:	PLASMID
	Fragment	:	HETERODIMERISATION DOMAIN RESIDUES 2-135
	Gene	:	CBFB
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

		1	2	3	4	5	6	7	8	9	10
Asymmetric Unit	:	A	B	C	D	E	F	G	H	Q	R
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D
Biological Unit 3 (1x)	:					E	F
Biological Unit 4 (1x)	:							G	H
Biological Unit 5 (1x)	:									Q
Biological Unit 6 (1x)	:										R

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1E50)

(no "Site" information available for 1E50)

(no "SS Bond" information available for 1E50)

Asymmetric Unit

No.	Residues
1	Asn A:155	-	Pro A:156
2	Asn C:155	-	Pro C:156
3	Asn E:155	-	Pro E:156
4	Asn G:155	-	Pro G:156
5	Asn Q:155	-	Pro Q:156
6	Asn R:155	-	Pro R:156

Asymmetric Unit (4, 17)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_036226	P	100	A	PEBB_HUMAN	Unclassified	---	B/D/F/H	P	100	A
2	CancerSNP	VAR_PEBB_HUMAN_CCDS10827_1_01 *	P	100	A	PEBB_HUMAN	Disease (Breast cancer)	---	B/D/F/H	P	100	A
3	UniProt	VAR_012128	R	139	Q	RUNX1_HUMAN	Disease (FPDMM)	---	A/C/E/G/Q/R	R	139	Q
4	UniProt	VAR_012129	R	174	Q	RUNX1_HUMAN	Disease (FPDMM)	74315450	C/E/G	R	174	Q
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_036226	P	100	A	PEBB_HUMAN	Unclassified	---	B	P	100	A
2	CancerSNP	VAR_PEBB_HUMAN_CCDS10827_1_01 *	P	100	A	PEBB_HUMAN	Disease (Breast cancer)	---	B	P	100	A
3	UniProt	VAR_012128	R	139	Q	RUNX1_HUMAN	Disease (FPDMM)	---	A	R	139	Q
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_036226	P	100	A	PEBB_HUMAN	Unclassified	---	D	P	100	A
2	CancerSNP	VAR_PEBB_HUMAN_CCDS10827_1_01 *	P	100	A	PEBB_HUMAN	Disease (Breast cancer)	---	D	P	100	A
3	UniProt	VAR_012128	R	139	Q	RUNX1_HUMAN	Disease (FPDMM)	---	C	R	139	Q
4	UniProt	VAR_012129	R	174	Q	RUNX1_HUMAN	Disease (FPDMM)	74315450	C	R	174	Q
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_036226	P	100	A	PEBB_HUMAN	Unclassified	---	F	P	100	A
2	CancerSNP	VAR_PEBB_HUMAN_CCDS10827_1_01 *	P	100	A	PEBB_HUMAN	Disease (Breast cancer)	---	F	P	100	A
3	UniProt	VAR_012128	R	139	Q	RUNX1_HUMAN	Disease (FPDMM)	---	E	R	139	Q
4	UniProt	VAR_012129	R	174	Q	RUNX1_HUMAN	Disease (FPDMM)	74315450	E	R	174	Q
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_036226	P	100	A	PEBB_HUMAN	Unclassified	---	H	P	100	A
2	CancerSNP	VAR_PEBB_HUMAN_CCDS10827_1_01 *	P	100	A	PEBB_HUMAN	Disease (Breast cancer)	---	H	P	100	A
3	UniProt	VAR_012128	R	139	Q	RUNX1_HUMAN	Disease (FPDMM)	---	G	R	139	Q
4	UniProt	VAR_012129	R	174	Q	RUNX1_HUMAN	Disease (FPDMM)	74315450	G	R	174	Q
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 5 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
3	UniProt	VAR_012128	R	139	Q	RUNX1_HUMAN	Disease (FPDMM)	---	Q	R	139	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 6 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
3	UniProt	VAR_012128	R	139	Q	RUNX1_HUMAN	Disease (FPDMM)	---	R	R	139	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 1E50)

Asymmetric Unit (9, 39)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000290858	1	ENSE00001297396	chr16:67063050-67063388	339	PEBB_HUMAN	1-26	26	4	B:2-26 D:2-26 F:2-26 H:2-26	25 25 25 25
1.2	ENST00000290858	2	ENSE00000688453	chr16:67063630-67063716	87	PEBB_HUMAN	27-55	29	4	B:27-55 D:27-55 F:27-55 H:27-55	29 29 29 29
1.3	ENST00000290858	3	ENSE00000688463	chr16:67070542-67070658	117	PEBB_HUMAN	56-94	39	4	B:56-94 (gaps) D:56-94 (gaps) F:56-94 (gaps) H:56-94 (gaps)	39 39 39 39
1.4	ENST00000290858	4	ENSE00001046833	chr16:67100585-67100701	117	PEBB_HUMAN	95-133	39	4	B:95-133 D:95-133 F:95-133 H:95-133	39 39 39 39
1.5b	ENST00000290858	5b	ENSE00001301640	chr16:67116116-67116242	127	PEBB_HUMAN	134-176	43	4	B:134-135 D:134-135 F:134-135 H:134-135	2 2 2 2
1.6b	ENST00000290858	6b	ENSE00001597074	chr16:67132613-67134961	2349	PEBB_HUMAN	176-182	7	0	-	-

2.18a	ENST00000344691	18a	ENSE00001380483	chr21:36260987-36259140	1848	RUNX1_HUMAN	1-90	90	6	A:59-90 C:54-90 E:57-90 G:57-90 Q:62-90 R:62-90	32 37 34 34 29 29
2.19c	ENST00000344691	19c	ENSE00001660291	chr21:36253010-36252854	157	RUNX1_HUMAN	91-143	53	6	A:91-143 C:91-143 E:91-143 G:91-143 Q:91-143 R:91-143	53 53 53 53 53 53
2.20a	ENST00000344691	20a	ENSE00002199204	chr21:36231875-36231771	105	RUNX1_HUMAN	143-178	36	6	A:143-173 C:143-178 E:143-175 G:143-175 Q:143-171 R:143-171	31 36 33 33 29 29
2.22a	ENST00000344691	22a	ENSE00002198909	chr21:36206898-36206707	192	RUNX1_HUMAN	178-242	65	1	- C:178-178 - - - -	- 1 - - - -
2.25	ENST00000344691	25	ENSE00002149931	chr21:36171759-36171598	162	RUNX1_HUMAN	242-296	55	0	-	-
2.26e	ENST00000344691	26e	ENSE00001623427	chr21:36164907-36160098	4810	RUNX1_HUMAN	296-453	158	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:115
 aligned with RUNX1_HUMAN | Q01196 from UniProtKB/Swiss-Prot  Length:453

    Alignment length:115
                                    68        78        88        98       108       118       128       138       148       158       168     
          RUNX1_HUMAN    59 PGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGP 173
               SCOP domains d1e50a_ A: Acute myeloid leukemia 1 protein (AML1), RUNT domain                                                     SCOP domains
               CATH domains 1e50A00 A:59-173  [code=2.60.40.720, no name defined]                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee.....eeee....eee.........eeee........eeeeeee............eee....eee................eeeeee.....eeeee....eee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------Q---------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.18a  PDB: A:59-90        Exon 2.19c  PDB: A:91-143 UniProt: 91-143            ------------------------------ Transcript 2 (1)
           Transcript 2 (2) ------------------------------------------------------------------------------------Exon 2.20a  PDB: A:143-173      Transcript 2 (2)
                 1e50 A  59 PGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGP 173
                                    68        78        88        98       108       118       128       138       148       158       168

Chain B from PDB  Type:PROTEIN  Length:130
 aligned with PEBB_HUMAN | Q13951 from UniProtKB/Swiss-Prot  Length:182

    Alignment length:134
                                    11        21        31        41        51        61        71        81        91       101       111       121       131    
           PEBB_HUMAN     2 PRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQE 135
               SCOP domains d1e50b_ B: Core binding factor beta, CBF                                                                                               SCOP domains
               CATH domains 1e50B00 B:2-135  [code=2.40.250.10, no name defined]                                                                                   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhh....eeeee......hhhhhhhhhhhhhhh.eeeeee.......eee......----................eeeeeeeeee..eeeeeeeeee....eeeeeeeehhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) --------------------------------------------------------------------------------------------------A----------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------A----------------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: B:2-26    Exon 1.2  PDB: B:27-55       Exon 1.3  PDB: B:56-94 (gaps)          Exon 1.4  PDB: B:95-133 UniProt: 95-1331. Transcript 1
                 1e50 B   2 PRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASW----RQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQE 135
                                    11        21        31        41        51        61        71 |    | 81        91       101       111       121       131    
                                                                                                  73   78

Chain C from PDB  Type:PROTEIN  Length:125
 aligned with RUNX1_HUMAN | Q01196 from UniProtKB/Swiss-Prot  Length:453

    Alignment length:125
                                    63        73        83        93       103       113       123       133       143       153       163       173     
          RUNX1_HUMAN    54 VLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR 178
               SCOP domains d1e50c_ C: Acute myeloid leukemia 1 protein (AML1), RUNT domain                                                               SCOP domains
               CATH domains 1e50C00 C:54-178  [code=2.60.40.720, no name defined]                                                                         CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eee.....eeee....eee.........eeee........eeeeeee............eee....eee................eeeeee.....eeeee....eee......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------Q----------------------------------Q---- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.18a  PDB: C:54-90 [INCOMPLETE]Exon 2.19c  PDB: C:91-143 UniProt: 91-143            ----------------------------------2 Transcript 2 (1)
           Transcript 2 (2) -----------------------------------------------------------------------------------------Exon 2.20a  PDB: C:143-178           Transcript 2 (2)
                 1e50 C  54 VLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR 178
                                    63        73        83        93       103       113       123       133       143       153       163       173

Chain D from PDB  Type:PROTEIN  Length:125
 aligned with PEBB_HUMAN | Q13951 from UniProtKB/Swiss-Prot  Length:182

    Alignment length:134
                                    11        21        31        41        51        61        71        81        91       101       111       121       131    
           PEBB_HUMAN     2 PRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQE 135
               SCOP domains d1e50d_ D: Core binding factor beta, CBF                                                                                               SCOP domains
               CATH domains 1e50D00 D:2-135  [code=2.40.250.10, no name defined]                                                                                   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhh.eeeee......hhhhhhhhhhhhhhh.eeeeee....eeeeee...---------..............eeeeeeeeee..eeeeeeeeee....eeeeeeeehhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) --------------------------------------------------------------------------------------------------A----------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------A----------------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: D:2-26    Exon 1.2  PDB: D:27-55       Exon 1.3  PDB: D:56-94 (gaps)          Exon 1.4  PDB: D:95-133 UniProt: 95-1331. Transcript 1
                 1e50 D   2 PRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFP---------TPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQE 135
                                    11        21        31        41        51        61        |-        81        91       101       111       121       131    
                                                                                               70        80

Chain E from PDB  Type:PROTEIN  Length:119
 aligned with RUNX1_HUMAN | Q01196 from UniProtKB/Swiss-Prot  Length:453

    Alignment length:119
                                    66        76        86        96       106       116       126       136       146       156       166         
          RUNX1_HUMAN    57 DHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPRE 175
               SCOP domains d1e50e_ E: Acute myeloid leukemia 1 protein (AML1), RUNT domain                                                         SCOP domains
               CATH domains 1e50E00 E:57-175  [code=2.60.40.720, no name defined]                                                                   CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee.....eeee....eee.........eeee........eeeeeee............eee....eee................eeeeee.....eeeee....eee...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------Q----------------------------------Q- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.18a  PDB: E:57-90          Exon 2.19c  PDB: E:91-143 UniProt: 91-143            -------------------------------- Transcript 2 (1)
           Transcript 2 (2) --------------------------------------------------------------------------------------Exon 2.20a  PDB: E:143-175        Transcript 2 (2)
                 1e50 E  57 DHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPRE 175
                                    66        76        86        96       106       116       126       136       146       156       166

Chain F from PDB  Type:PROTEIN  Length:125
 aligned with PEBB_HUMAN | Q13951 from UniProtKB/Swiss-Prot  Length:182

    Alignment length:134
                                    11        21        31        41        51        61        71        81        91       101       111       121       131    
           PEBB_HUMAN     2 PRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQE 135
               SCOP domains d1e50f_ F: Core binding factor beta, CBF                                                                                               SCOP domains
               CATH domains 1e50F00 F:2-135  [code=2.40.250.10, no name defined]                                                                                   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhh.eeeee......hhhhhhhhhhhhhhh.eeeeee....eeeeee...---------..............eeeeeeeeee..eeeeeeeeee....eeeeeeeehhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) --------------------------------------------------------------------------------------------------A----------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------A----------------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: F:2-26    Exon 1.2  PDB: F:27-55       Exon 1.3  PDB: F:56-94 (gaps)          Exon 1.4  PDB: F:95-133 UniProt: 95-1331. Transcript 1
                 1e50 F   2 PRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFP---------TPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQE 135
                                    11        21        31        41        51        61        |-        81        91       101       111       121       131    
                                                                                               70        80

Chain G from PDB  Type:PROTEIN  Length:119
 aligned with RUNX1_HUMAN | Q01196 from UniProtKB/Swiss-Prot  Length:453

    Alignment length:119
                                    66        76        86        96       106       116       126       136       146       156       166         
          RUNX1_HUMAN    57 DHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPRE 175
               SCOP domains d1e50g_ G: Acute myeloid leukemia 1 protein (AML1), RUNT domain                                                         SCOP domains
               CATH domains 1e50G00 G:57-175  [code=2.60.40.720, no name defined]                                                                   CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee.....eeee....eee.........eeee........eeeeeee............eee....eee................eeeeee.....eeeee....eee...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------Q----------------------------------Q- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.18a  PDB: G:57-90          Exon 2.19c  PDB: G:91-143 UniProt: 91-143            -------------------------------- Transcript 2 (1)
           Transcript 2 (2) --------------------------------------------------------------------------------------Exon 2.20a  PDB: G:143-175        Transcript 2 (2)
                 1e50 G  57 DHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPRE 175
                                    66        76        86        96       106       116       126       136       146       156       166

Chain H from PDB  Type:PROTEIN  Length:130
 aligned with PEBB_HUMAN | Q13951 from UniProtKB/Swiss-Prot  Length:182

    Alignment length:134
                                    11        21        31        41        51        61        71        81        91       101       111       121       131    
           PEBB_HUMAN     2 PRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQE 135
               SCOP domains d1e50h_ H: Core binding factor beta, CBF                                                                                               SCOP domains
               CATH domains 1e50H00 H:2-135  [code=2.40.250.10, no name defined]                                                                                   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhh.eeeee......hhhhhhhhhhhhhhh.eeeeee.......eee......----................eeeeeeeeee..eeeeeeeeee....eeeeeeeehhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) --------------------------------------------------------------------------------------------------A----------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------A----------------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: H:2-26    Exon 1.2  PDB: H:27-55       Exon 1.3  PDB: H:56-94 (gaps)          Exon 1.4  PDB: H:95-133 UniProt: 95-1331. Transcript 1
                 1e50 H   2 PRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASW----RQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQE 135
                                    11        21        31        41        51        61        71 |    | 81        91       101       111       121       131    
                                                                                                  73   78

Chain Q from PDB  Type:PROTEIN  Length:110
 aligned with RUNX1_HUMAN | Q01196 from UniProtKB/Swiss-Prot  Length:453

    Alignment length:110
                                    71        81        91       101       111       121       131       141       151       161       171
          RUNX1_HUMAN    62 LVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVD 171
               SCOP domains d1e50q_ Q: Acute myeloid leukemia 1 protein (AML1), RUNT domain                                                SCOP domains
               CATH domains 1e50Q00 Q:62-171  [code=2.60.40.720, no name defined]                                                          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eee.....eee.........eeee........eee................eee....eee.................eeeee.....eeeee....eee.. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------Q-------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.18a  PDB: Q:62-90     Exon 2.19c  PDB: Q:91-143 UniProt: 91-143            ---------------------------- Transcript 2 (1)
           Transcript 2 (2) ---------------------------------------------------------------------------------Exon 2.20a  PDB: Q:143-171    Transcript 2 (2)
                 1e50 Q  62 LVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVD 171
                                    71        81        91       101       111       121       131       141       151       161       171

Chain R from PDB  Type:PROTEIN  Length:110
 aligned with RUNX1_HUMAN | Q01196 from UniProtKB/Swiss-Prot  Length:453

    Alignment length:110
                                    71        81        91       101       111       121       131       141       151       161       171
          RUNX1_HUMAN    62 LVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVD 171
               SCOP domains d1e50r_ R: Acute myeloid leukemia 1 protein (AML1), RUNT domain                                                SCOP domains
               CATH domains 1e50R00 R:62-171  [code=2.60.40.720, no name defined]                                                          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eee.....eee........eeeee........eee................eee....eeee................eeeee.....eeeee....eee.. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------Q-------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.18a  PDB: R:62-90     Exon 2.19c  PDB: R:91-143 UniProt: 91-143            ---------------------------- Transcript 2 (1)
           Transcript 2 (2) ---------------------------------------------------------------------------------Exon 2.20a  PDB: R:143-171    Transcript 2 (2)
                 1e50 R  62 LVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVD 171
                                    71        81        91       101       111       121       131       141       151       161       171

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Beta Barrel (4804)

Topology: Polyomavirus Enhancer Binding Protein 2; Chain: A; (6)

Homologous Superfamily: [code=2.40.250.10, no name defined] (6)

Human (Homo sapiens) (3)

1a	1e50B00	B:2-135
1b	1e50H00	H:2-135
1c	1e50D00	D:2-135
1d	1e50F00	F:2-135

Architecture: Sandwich (5577)

Topology: Immunoglobulin-like (3897)

Homologous Superfamily: [code=2.60.40.720, no name defined] (49)

Human (Homo sapiens) (29)

2a	1e50C00	C:54-178
2b	1e50E00	E:57-175
2c	1e50G00	G:57-175
2d	1e50A00	A:59-173
2e	1e50Q00	Q:62-171
2f	1e50R00	R:62-171

(no "Pfam Domain" information available for 1E50)

Asymmetric Unit(hide GO term definitions)

Chain A,C,E,G,Q,R (RUNX1_HUMAN | Q01196)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0000977	RNA polymerase II regulatory region sequence-specific DNA binding	Interacting selectively and non-covalently with a specific sequence of DNA that is part of a regulatory region that controls the transcription of a gene or cistron by RNA polymerase II.
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0001047	core promoter binding	Interacting selectively and non-covalently with the regulatory region composed of the transcription start site and binding sites for the basal transcription machinery. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046982	protein heterodimerization activity	Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0000975	regulatory region DNA binding	Interacting selectively and non-covalently with a DNA region that regulates a DNA-based process. Such processes include transcription, DNA replication, and DNA repair.
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
	GO:0001228	transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding	Interacting selectively and non-covalently with a sequence of DNA that is in the transcription regulatory region for RNA polymerase II (RNAP II) in order to activate or increase the frequency, rate or extent of transcription from the RNAP II promoter.
biological process
	GO:0002062	chondrocyte differentiation	The process in which a chondroblast acquires specialized structural and/or functional features of a chondrocyte. A chondrocyte is a polymorphic cell that forms cartilage.
	GO:0071425	hematopoietic stem cell proliferation	The expansion of a hematopoietic stem cell population by cell division. A hematopoietic stem cell is a stem cell from which all cells of the lymphoid and myeloid lineages develop.
	GO:0030097	hemopoiesis	The process whose specific outcome is the progression of the myeloid and lymphoid derived organ/tissue systems of the blood and other parts of the body over time, from formation to the mature structure. The site of hemopoiesis is variable during development, but occurs primarily in bone marrow or kidney in many adult vertebrates.
	GO:0030099	myeloid cell differentiation	The process in which a relatively unspecialized myeloid precursor cell acquires the specialized features of any cell of the myeloid leukocyte, megakaryocyte, thrombocyte, or erythrocyte lineages.
	GO:0030853	negative regulation of granulocyte differentiation	Any process that stops, prevents, or reduces the frequency, rate or extent of granulocyte differentiation.
	GO:0001503	ossification	The formation of bone or of a bony substance, or the conversion of fibrous tissue or of cartilage into bone or a bony substance.
	GO:0048935	peripheral nervous system neuron development	The process whose specific outcome is the progression of a neuron whose cell body is located in the peripheral nervous system, from initial commitment of the cell to a neuronal fate, to the fully functional differentiated neuron.
	GO:0045766	positive regulation of angiogenesis	Any process that activates or increases angiogenesis.
	GO:0030854	positive regulation of granulocyte differentiation	Any process that activates or increases the frequency, rate or extent of granulocyte differentiation.
	GO:0032743	positive regulation of interleukin-2 production	Any process that activates or increases the frequency, rate, or extent of interleukin-2 production.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006366	transcription from RNA polymerase II promoter	The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0043231	intracellular membrane-bounded organelle	Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B,D,F,H (PEBB_HUMAN | Q13951)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0003713	transcription coactivator activity	Interacting selectively and non-covalently with a activating transcription factor and also with the basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between activating transcription factors and the basal transcription machinery.
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
	GO:0048469	cell maturation	A developmental process, independent of morphogenetic (shape) change, that is required for a cell to attain its fully functional state.
	GO:0060216	definitive hemopoiesis	A second wave of blood cell production that, in vertebrates, generates long-term hemopoietic stem cells that continously provide erythroid, myeloid and lymphoid lineages throughout adulthood.
	GO:0030098	lymphocyte differentiation	The process in which a relatively unspecialized precursor cell acquires specialized features of a lymphocyte. A lymphocyte is a leukocyte commonly found in the blood and lymph that has the characteristics of a large nucleus, a neutral staining cytoplasm, and prominent heterochromatin.
	GO:0030099	myeloid cell differentiation	The process in which a relatively unspecialized myeloid precursor cell acquires the specialized features of any cell of the myeloid leukocyte, megakaryocyte, thrombocyte, or erythrocyte lineages.
	GO:0001503	ossification	The formation of bone or of a bony substance, or the conversion of fibrous tissue or of cartilage into bone or a bony substance.
	GO:0001649	osteoblast differentiation	The process whereby a relatively unspecialized cell acquires the specialized features of an osteoblast, a mesodermal or neural crest cell that gives rise to bone.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0000209	protein polyubiquitination	Addition of multiple ubiquitin groups to a protein, forming a ubiquitin chain.
	GO:0006366	transcription from RNA polymerase II promoter	The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1e50)

	Sites
(no "Sites" information available for 1e50)

	Cis Peptide Bonds
		Asn A:155 - Pro A:156	[ RasMol ]
		Asn C:155 - Pro C:156	[ RasMol ]
		Asn E:155 - Pro E:156	[ RasMol ]
		Asn G:155 - Pro G:156	[ RasMol ]
		Asn Q:155 - Pro Q:156	[ RasMol ]
		Asn R:155 - Pro R:156	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]
		Biological Unit 5	[ Jena3D ]
		Biological Unit 6	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format \| Biol. Unit 5 PNG format \| Biol. Unit 6 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1e50
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PEBB_HUMAN \| Q13951
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	RUNX1_HUMAN \| Q01196
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	601399
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PEBB_HUMAN \| Q13951
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	RUNX1_HUMAN \| Q01196
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	PEBB_HUMAN \| Q13951	:	1cl3 1h9d 4n9f
	RUNX1_HUMAN \| Q01196	:	1cmo 1co1 1h9d 1ljm

(no "Related Entries Specified in the PDB File" available for 1E50)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (4, 17)

PROSITE Motifs (0, 0)

Exons (9, 39)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 10)

CATH Domains (2, 10)

Pfam Domains (0, 0)

Gene Ontology (38, 46)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File