|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1E0R) |
Sites (0, 0)| (no "Site" information available for 1E0R) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1E0R) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1E0R) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1E0R) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1E0R) |
Exons (0, 0)| (no "Exon" information available for 1E0R) |
Sequences/Alignments
Asymmetric UnitChain B from PDB Type:PROTEIN Length:154 aligned with THSB_THEAC | P48425 from UniProtKB/Swiss-Prot Length:543 Alignment length:167 223 233 243 253 263 273 283 293 303 313 323 333 343 353 363 373 THSB_THEAC 214 INGIIVDKEKVHPGMPDVVKDAKIALLDAPLEIKKPEFDTNLRIEDPSMIQKFLAQEENMLREMVDKIKSVGANVVITQKGIDDMAQHYLSRAGIYAVRRVKKSDMDKLAKATGASIVSTIDEISSSDLGTAERVEQVKVGEDYMTFVTGCKNPKAVSILVRGETEH 380 SCOP domains d1e0rb_ B: Thermosome, A-domain SCOP domains CATH domains 1e0rB00 B:214-367 GroEL CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1e0r B 214 MNGIIVDKEKVHPGMPDVVKDAKIALLDAPLEIKKPEFDTNLRIEDPSMIQKFLAQEENMLREMVDKIKSVGANVVITQKGIDDMAQHYLSRAGIYAVRRVKKSDMDKLAKATGASIVSTIDEISSSDLGTAERVEQVKVGEDYMTFVTGSKN-------------H 367 223 233 243 253 263 273 283 293 303 313 323 333 343 353 363 | - | 366 367
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1E0R) |
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain B (THSB_THEAC | P48425)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|