1DS6 - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF A RAC-RHOGDI COMPLEX

Authors :   K. Scheffzek, I. Stephan, O. N. Jensen, D. Illenberger, P. Gierschik

Date :   07 Jan 00 (Deposition) - 12 Jul 00 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.35

Chains :   Asym./Biol. Unit : A,B

Keywords :   Beta Sandwhich, Protein-Protein Complex, G-Domain, Immunoglobulin Fold, Walker Fold, Gtp-Binding Protein, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. Scheffzek, I. Stephan, O. N. Jensen, D. Illenberger, P. Gierschik
The Rac-Rhogdi Complex And The Structural Basis For The Regulation Of Rho Proteins By Rhogdi.
Nat. Struct. Biol. V. 7 122 2000
PubMed-ID: 10655614 | Reference-DOI: 10.1038/72392
(for further references see the PDB file header)

Molecule 1 - RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
	Cell	:	LEUKOCYTE
	Cellular Location	:	CYTOPLASM
	Chains	:	A
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Common	:	FALL ARMYWORM
	Expression System Taxid	:	7108
	Expression System Vector	:	BACULOVIRUS
	Expression System Vector Type	:	VIRUS
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	P21-RAC2
	Tissue	:	BLOOD

Molecule 2 - RHO GDP-DISSOCIATION INHIBITOR 2
	Cell	:	LEUKOCYTE
	Cellular Location	:	CYTOPLASM
	Chains	:	B
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Common	:	FALL ARMYWORM
	Expression System Taxid	:	7108
	Expression System Vector	:	BACULOVIRUS
	Expression System Vector Type	:	VIRUS
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	RHO GDI 2, RHO-GDI BETA, LY-GDI
	Tissue	:	BLOOD

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 2)

No.	Name	Count	Type	Full Name
1	GDP	1	Ligand/Ion	GUANOSINE-5'-DIPHOSPHATE
2	MG	1	Ligand/Ion	MAGNESIUM ION

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	THR A:17 , THR A:35 , GDP A:194 , HOH A:509 , HOH A:539 , HOH A:550	BINDING SITE FOR RESIDUE MG A 193
2	AC2	SOFTWARE	ASP A:11 , GLY A:12 , ALA A:13 , VAL A:14 , GLY A:15 , LYS A:16 , THR A:17 , CYS A:18 , PHE A:28 , ILE A:33 , LYS A:116 , ASP A:118 , LEU A:119 , SER A:158 , ALA A:159 , LEU A:160 , MG A:193 , HOH A:531 , HOH A:539 , HOH A:547 , HOH A:550 , HOH A:576 , HOH A:592 , HOH A:593 , HOH A:628	BINDING SITE FOR RESIDUE GDP A 194

(no "SS Bond" information available for 1DS6)

(no "Cis Peptide Bond" information available for 1DS6)

Asymmetric/Biological Unit (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_036569	P	29	L	RAC2_HUMAN	Unclassified	---	A	P	29	L
2	UniProt	VAR_017452	D	57	N	RAC2_HUMAN	Disease (NEUID)	74315507	A	D	57	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RHO	PS51420	small GTPase Rho family profile.	RAC2_HUMAN	1-176	1	A:1-176

Asymmetric/Biological Unit (11, 11)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000228945	1	ENSE00000999866	chr12:15114562-15114471	92	GDIR2_HUMAN	-	0	0	-	-
1.2	ENST00000228945	2	ENSE00000822115	chr12:15103658-15103466	193	GDIR2_HUMAN	1-61	61	1	B:22-61	40
1.3	ENST00000228945	3	ENSE00000723045	chr12:15102819-15102736	84	GDIR2_HUMAN	61-89	29	1	B:61-89	29
1.4	ENST00000228945	4	ENSE00000723044	chr12:15100883-15100807	77	GDIR2_HUMAN	89-114	26	1	B:89-114	26
1.5	ENST00000228945	5	ENSE00000723043	chr12:15097773-15097710	64	GDIR2_HUMAN	115-136	22	1	B:115-136	22
1.6	ENST00000228945	6	ENSE00000999867	chr12:15095655-15094950	706	GDIR2_HUMAN	136-201	66	1	B:136-200	65

2.1e	ENST00000249071	1e	ENSE00001045309	chr22:37640310-37640154	157	RAC2_HUMAN	1-12	12	1	A:1-12	12
2.2	ENST00000249071	2	ENSE00001751320	chr22:37637698-37637627	72	RAC2_HUMAN	12-36	25	1	A:12-36	25
2.4a	ENST00000249071	4a	ENSE00001771444	chr22:37628958-37628841	118	RAC2_HUMAN	36-75	40	1	A:36-75	40
2.5	ENST00000249071	5	ENSE00000653854	chr22:37628034-37627972	63	RAC2_HUMAN	76-96	21	1	A:76-96	21
2.6b	ENST00000249071	6b	ENSE00001668004	chr22:37627430-37627271	160	RAC2_HUMAN	97-150	54	1	A:97-150	54
2.7c	ENST00000249071	7c	ENSE00000880141	chr22:37622843-37622711	133	RAC2_HUMAN	150-192	43	1	A:150-181	32
2.8d	ENST00000249071	8d	ENSE00001875917	chr22:37622079-37621301	779	RAC2_HUMAN	-	0	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:181
 aligned with RAC2_HUMAN | P15153 from UniProtKB/Swiss-Prot  Length:192

    Alignment length:181
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180 
           RAC2_HUMAN     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQP 181
               SCOP domains d1ds6a_ A: Rac                                                                                                                                                                        SCOP domains
               CATH domains 1ds6A00 A:1-181 P-loop containing nucleotide triphosphate hydrolases                                                                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeee....hhhhhhhhhhhh.............eeeeee....eeeeeee....hhhhh.hhhhhh....eeeeeee..hhhhhhhhhhhhhhhhhhhh....eeeeeehhhhh.hhhhhhhhhhh.....hhhhhhhhhhhh...eeee.......hhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------L---------------------------N---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE RHO  PDB: A:1-176 UniProt: 1-176                                                                                                                                                ----- PROSITE
           Transcript 2 (1) Exon 2.1e   -----------------------Exon 2.4a  PDB: A:36-75 UniProt: 36-75  Exon 2.5  PDB: A:76-9Exon 2.6b  PDB: A:97-150 UniProt: 97-150              ------------------------------- Transcript 2 (1)
           Transcript 2 (2) -----------Exon 2.2  PDB: A:12-36   -----------------------------------------------------------------------------------------------------------------Exon 2.7c  PDB: A:150-181        Transcript 2 (2)
                 1ds6 A   1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQP 181
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180

Chain B from PDB  Type:PROTEIN  Length:179
 aligned with GDIR2_HUMAN | P52566 from UniProtKB/Swiss-Prot  Length:201

    Alignment length:179
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191         
          GDIR2_HUMAN    22 LNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWT 200
               SCOP domains d1ds6b_ B: Rho GDP-dissociation inhibitor 1, RhoGDI                                                                                                                                 SCOP domains
               CATH domains 1ds6B00 B:22-200 Coagulation Factor XIII, subunit A, domain 1                                                                                                                       CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhhh...hhhhhhhhhhhh...............eeeeeee........eee...hhhhhhhheeeee...eeeeeeee......eeeeeeeeeeee..eeeeeeeeeeeee......eeee...ee........eeeeeeeeee.......eeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: B:22-61 UniProt: 1-61    ---------------------------Exon 1.4  PDB: B:89-114   Exon 1.5              ---------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------Exon 1.3  PDB: B:61-89       ----------------------------------------------Exon 1.6  PDB: B:136-200 UniProt: 136-201 [INCOMPLETE]            Transcript 1 (2)
                 1ds6 B  22 GNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWG 200
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: P-loop containing nucleotide triphosphate hydrolases (1378)

Human (Homo sapiens) (413)

1ds6A00

A:1-181

Class: Mainly Beta (13760)

Architecture: Distorted Sandwich (506)

Topology: Coagulation Factor XIII; Chain A, domain 1 (28)

Homologous Superfamily: Coagulation Factor XIII, subunit A, domain 1 (22)

Human (Homo sapiens) (20)

1ds6B00

B:22-200

(no "Pfam Domain" information available for 1DS6)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (RAC2_HUMAN | P15153)

molecular function
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0003924	GTPase activity	Catalysis of the reaction: GTP + H2O = GDP + phosphate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0019887	protein kinase regulator activity	Modulates the activity of a protein kinase, an enzyme which phosphorylates a protein.
biological process
	GO:0007186	G-protein coupled receptor signaling pathway	A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
	GO:0030036	actin cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
	GO:0007015	actin filament organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments. Includes processes that control the spatial distribution of actin filaments, such as organizing filaments into meshworks, bundles, or other structures, as by cross-linking.
	GO:0045453	bone resorption	The process in which specialized cells known as osteoclasts degrade the organic and inorganic portions of bone, and endocytose and transport the degradation products.
	GO:0030031	cell projection assembly	Formation of a prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0006935	chemotaxis	The directed movement of a motile cell or organism, or the directed growth of a cell guided by a specific chemical concentration gradient. Movement may be towards a higher concentration (positive chemotaxis) or towards a lower concentration (negative chemotaxis).
	GO:0071593	lymphocyte aggregation	The adhesion of one lymphocyte to one or more other lymphocytes via adhesion molecules.
	GO:0030168	platelet activation	A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0010592	positive regulation of lamellipodium assembly	Any process that increases the rate, frequency or extent of the formation of a lamellipodium, a thin sheetlike extension of the surface of a migrating cell.
	GO:0090023	positive regulation of neutrophil chemotaxis	Any process that increases the frequency, rate, or extent of neutrophil chemotaxis. Neutrophil chemotaxis is the directed movement of a neutrophil cell, the most numerous polymorphonuclear leukocyte found in the blood, in response to an external stimulus, usually an infection or wounding.
	GO:1903955	positive regulation of protein targeting to mitochondrion	Any process that activates or increases the frequency, rate or extent of protein targeting to mitochondrion.
	GO:0042129	regulation of T cell proliferation	Any process that modulates the frequency, rate or extent of T cell proliferation.
	GO:0010810	regulation of cell-substrate adhesion	Any process that modulates the frequency, rate or extent of cell-substrate adhesion. Cell-substrate adhesion is the attachment of a cell to the underlying substrate via adhesion molecules.
	GO:0010310	regulation of hydrogen peroxide metabolic process	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways involving hydrogen peroxide.
	GO:0060753	regulation of mast cell chemotaxis	Any process that modulates the rate, frequency or extent of mast cell chemotaxis. Mast cell chemotaxis is the movement of a mast cell in response to an external stimulus.
	GO:0043304	regulation of mast cell degranulation	Any process that modulates the frequency, rate, or extent of mast cell degranulation.
	GO:1902622	regulation of neutrophil migration	Any process that modulates the frequency, rate or extent of neutrophil migration.
	GO:0045859	regulation of protein kinase activity	Any process that modulates the frequency, rate or extent of protein kinase activity.
	GO:0060263	regulation of respiratory burst	Any process that modulates the rate frequency or extent of a phase of elevated metabolic activity, during which oxygen consumption increases; this leads to the production, by an NADH dependent system, of hydrogen peroxide (H2O2), superoxide anions and hydroxyl radicals.
	GO:0051056	regulation of small GTPase mediated signal transduction	Any process that modulates the frequency, rate or extent of small GTPase mediated signal transduction.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0007264	small GTPase mediated signal transduction	Any series of molecular signals in which a small monomeric GTPase relays one or more of the signals.
cellular component
	GO:0005884	actin filament	A filamentous structure formed of a two-stranded helical polymer of the protein actin and associated proteins. Actin filaments are a major component of the contractile apparatus of skeletal muscle and the microfilaments of the cytoskeleton of eukaryotic cells. The filaments, comprising polymerized globular actin molecules, appear as flexible structures with a diameter of 5-9 nm. They are organized into a variety of linear bundles, two-dimensional networks, and three dimensional gels. In the cytoskeleton they are most highly concentrated in the cortex of the cell just beneath the plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0030027	lamellipodium	A thin sheetlike process extended by the leading edge of a migrating cell or extending cell process; contains a dense meshwork of actin filaments.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005635	nuclear envelope	The double lipid bilayer enclosing the nucleus and separating its contents from the rest of the cytoplasm; includes the intermembrane space, a gap of width 20-40 nm (also called the perinuclear space).
	GO:0030670	phagocytic vesicle membrane	The lipid bilayer surrounding a phagocytic vesicle.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain B (GDIR2_HUMAN | P52566)

molecular function
	GO:0005096	GTPase activator activity	Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP.
	GO:0003924	GTPase activity	Catalysis of the reaction: GTP + H2O = GDP + phosphate.
	GO:0048365	Rac GTPase binding	Interacting selectively and non-covalently with Rac protein, any member of the Rac subfamily of the Ras superfamily of monomeric GTPases.
	GO:0005094	Rho GDP-dissociation inhibitor activity	Prevents the dissociation of GDP from the small GTPase Rho, thereby preventing GTP from binding.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0071461	cellular response to redox state	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating redox state. Redox state refers to the balance of oxidized versus reduced forms of electron donors and acceptors in an organelle, cell or organ; plastoquinone, glutathione (GSH/GSSG), and nicotinamide nucleotides (NAD+/NADH and NADP+/NADPH) are among the most important.
	GO:0006928	movement of cell or subcellular component	The directed, self-propelled movement of a cell or subcellular component without the involvement of an external agent such as a transporter or a pore.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:0007162	negative regulation of cell adhesion	Any process that stops, prevents, or reduces the frequency, rate or extent of cell adhesion.
	GO:1901164	negative regulation of trophoblast cell migration	Any process that stops, prevents or reduces the frequency, rate or extent of trophoblast cell migration.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:0035023	regulation of Rho protein signal transduction	Any process that modulates the frequency, rate or extent of Rho protein signal transduction.
	GO:2000249	regulation of actin cytoskeleton reorganization	Any process that modulates the frequency, rate or extent of actin cytoskeleton reorganization.
	GO:0050790	regulation of catalytic activity	Any process that modulates the activity of an enzyme.
	GO:0051056	regulation of small GTPase mediated signal transduction	Any process that modulates the frequency, rate or extent of small GTPase mediated signal transduction.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GDP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ds6)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1ds6
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GDIR2_HUMAN \| P52566
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	RAC2_HUMAN \| P15153
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	608203
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GDIR2_HUMAN \| P52566
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	RAC2_HUMAN \| P15153
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	GDIR2_HUMAN \| P52566	:	5h1d
	RAC2_HUMAN \| P15153	:	2w2t 2w2v 2w2x

(no "Related Entries Specified in the PDB File" available for 1DS6)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 2)

PROSITE Motifs (1, 1)

Exons (11, 11)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (2, 2)

Pfam Domains (0, 0)

Gene Ontology (51, 57)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File