|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
NMR Structure (1, 2)
|
NMR Structure (4, 4)
|
(no "SS Bond" information available for 1DAQ) |
(no "Cis Peptide Bond" information available for 1DAQ) |
(no "SAP(SNP)/Variant" information available for 1DAQ) |
NMR Structure (2, 3)
|
(no "Exon" information available for 1DAQ) |
NMR StructureChain A from PDB Type:PROTEIN Length:71 aligned with GUNS_CLOTH | A3DH67 from UniProtKB/Swiss-Prot Length:741 Alignment length:89 741 663 673 683 693 703 713 723 733 | GUNS_CLOTH 654 MGVLATYFPDMTYKVPGTPSTKLYGDVNDDGKVNSTDAVALKRYVLRSGISINTDNADLNEDGRVNSTDLGILKRYILKEIDTLPYKN- - SCOP domains d 1daqa_ A: Cellulosome endoglucanase SS SCOP domains CATH domains 1 daqA00 A:1-71 Type 1 dockerin domain CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains Chain A from PDB Type:PROTEIN Length:71 aligned with GUNS_CLOTM | P0C2S5 from UniProtKB/Swiss-Prot Length:741 Alignment length:89 741 663 673 683 693 703 713 723 733 | GUNS_CLOTM 654 MGVLATYFPDMTYKVPGTPSTKLYGDVNDDGKVNSTDAVALKRYVLRSGISINTDNADLNEDGRVNSTDLGILKRYILKEIDTLPYKN- - SCOP domains d 1daqa_ A: Cellulosome endoglucanase SS SCOP domains CATH domains 1 daqA00 A:1-71 Type 1 dockerin domain CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains
|
NMR Structure
|
NMR Structure
|
(no "Pfam Domain" information available for 1DAQ) |
NMR Structure(hide GO term definitions) Chain A (GUNS_CLOTH | A3DH67)
Chain A (GUNS_CLOTM | P0C2S5)
|
|
|
|
|
|
|