Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF E6AP: INSIGHTS INTO UBIQUITINATION PATHWAY
 
Authors :  L. Huang, E. Kinnucan, G. Wang, S. Beaudenon, P. M. Howley, J. M. Huibregtse, N. P. Pavletich
Date :  14 Oct 99  (Deposition) - 17 Nov 99  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Bilobal Structure, Elongated Shape, E3 Ubiquitin Ligase, E2 Ubiquitin Conjugating Enzyme (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. Huang, E. Kinnucan, G. Wang, S. Beaudenon, P. M. Howley, J. M. Huibregtse, N. P. Pavletich
Structure Of An E6Ap-Ubch7 Complex: Insights Into Ubiquitination By The E2-E3 Enzyme Cascade.
Science V. 286 1321 1999
PubMed-ID: 10558980  |  Reference-DOI: 10.1126/SCIENCE.286.5443.1321
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - UBIQUITIN-PROTEIN LIGASE E3A
    ChainsA, B, C
    EC Number6.3.2.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPGEX4T-3
    Expression System Taxid562
    FragmentHECT CATALYTIC DOMAIN
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymE6AP
 
Molecule 2 - UBIQUITIN CONJUGATING ENZYME E2
    ChainsD
    EC Number6.3.2.19
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET
    Expression System Taxid562
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymUBCH7

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1C4Z)

(-) Sites  (0, 0)

(no "Site" information available for 1C4Z)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1C4Z)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Tyr D:61 -Pro D:62

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (10, 30)

Asymmetric/Biological Unit (10, 30)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_073209G568RUBE3A_HUMANUnclassified (AS)587781233A/B/CG545R
02UniProtVAR_073210M589KUBE3A_HUMANUnclassified (AS)587781244A/B/CM566K
03UniProtVAR_073211E607QUBE3A_HUMANUnclassified (AS)587781235A/B/CE584Q
04UniProtVAR_073212Q611EUBE3A_HUMANPolymorphism587782918A/B/CQ588E
05UniProtVAR_073213Q611PUBE3A_HUMANPolymorphism587782919A/B/CQ588P
06UniProtVAR_073214T679IUBE3A_HUMANUnclassified (AS)587781236A/B/CT656I
07UniProtVAR_073215L696RUBE3A_HUMANPolymorphism587782920A/B/CL673R
08UniProtVAR_073216F713CUBE3A_HUMANUnclassified (AS)587781237A/B/CF690C
09UniProtVAR_073217V785IUBE3A_HUMANPolymorphism587782910A/B/CV762I
10UniProtVAR_073218P850LUBE3A_HUMANUnclassified (AS)587781239A/B/CP827L

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 5)

Asymmetric/Biological Unit (3, 5)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UB2L3_HUMAN5-138  1D:5-138
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UB2L3_HUMAN75-90  1D:75-90
3HECTPS50237 HECT domain profile.UBE3A_HUMAN547-875
 
 
  3A:524-846
B:524-846
C:524-846

(-) Exons   (12, 28)

Asymmetric/Biological Unit (12, 28)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2aENST000003421922aENSE00001369259chr22:21921836-21922060225UB2L3_HUMAN1-991D:4-96
1.3ENST000003421923ENSE00001385554chr22:21947150-2194724596UB2L3_HUMAN10-41321D:10-4132
1.4ENST000003421924ENSE00001391243chr22:21965146-21965332187UB2L3_HUMAN42-104631D:42-10463
1.5ENST000003421925ENSE00001389409chr22:21975804-219783232520UB2L3_HUMAN104-154511D:104-14744

2.4ENST000003979544ENSE00001530924chr15:25653795-2565376729UBE3A_HUMAN1-10100--
2.6cENST000003979546cENSE00001704572chr15:25650649-2565060842UBE3A_HUMAN10-24150--
2.7aENST000003979547aENSE00000815082chr15:25620910-25620612299UBE3A_HUMAN24-1241010--
2.8ENST000003979548ENSE00000815081chr15:25616959-256157131247UBE3A_HUMAN124-5394163A:497-516
B:497-516
C:497-516
20
20
20
2.9ENST000003979549ENSE00000778629chr15:25605674-25605530145UBE3A_HUMAN540-588493A:517-565
B:517-565
C:517-565
49
49
49
2.10ENST0000039795410ENSE00000778628chr15:25602043-25601838206UBE3A_HUMAN588-656693A:565-633
B:565-633
C:565-633
69
69
69
2.11ENST0000039795411ENSE00000778627chr15:25601203-25601039165UBE3A_HUMAN657-711553A:634-688
B:634-688
C:634-688
55
55
55
2.12ENST0000039795412ENSE00000815076chr15:25599830-25599675156UBE3A_HUMAN712-763523A:689-740
B:689-740
C:689-740
52
52
52
2.13ENST0000039795413ENSE00000815075chr15:25599573-2559950074UBE3A_HUMAN764-788253A:741-765
B:741-765
C:741-765
25
25
25
2.14ENST0000039795414ENSE00000815073chr15:25585375-25585232144UBE3A_HUMAN788-836493A:765-813
B:765-813
C:765-813
49
49
49
2.15bENST0000039795415bENSE00001243846chr15:25584404-255823962009UBE3A_HUMAN836-875403A:813-846
B:813-846
C:813-846
34
34
34

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:350
 aligned with UBE3A_HUMAN | Q05086 from UniProtKB/Swiss-Prot  Length:875

    Alignment length:350
                                   529       539       549       559       569       579       589       599       609       619       629       639       649       659       669       679       689       699       709       719       729       739       749       759       769       779       789       799       809       819       829       839       849       859       869
          UBE3A_HUMAN   520 NPYLRLKVRRDHIIDDALVRLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYA 869
               SCOP domains d1c4za_ A: Ubiquitin-protein ligase E3a (E6ap)                                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee...hhhhhhhhhhhhhhhhhhhhhhh...eee........hhhhhhhhhhhhhhhhhhhhh.eee......eee......hhhhhhhhhhhhhhhhhh........hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh..hhhhhh....eeee.......eeee.............hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh.........hhhhhhhhhh.............eee......hhhhhhhhhhhhh.hhhhhhhhhhhhh........hhhhhh.eeeeeee......eeehhh.eeeeee..hhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) ------------------------------------------------R--------------------K-----------------Q---E-------------------------------------------------------------------I----------------R----------------C-----------------------------------------------------------------------I----------------------------------------------------------------L------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------------------------------P------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                    PROSITE ---------------------------HECT  PDB: A:524-846 UniProt: 547-875                                                                                                                                                                                                                                                                                               PROSITE
           Transcript 2 (1) Exon 2.8            ------------------------------------------------Exon 2.10  PDB: A:565-633 UniProt: 588-656                           Exon 2.11  PDB: A:634-688 UniProt: 657-711             Exon 2.12  PDB: A:689-740 UniProt: 712-763          Exon 2.13  PDB: A:741-765-----------------------------------------------Exon 2.15b  PDB: A:813-846         Transcript 2 (1)
           Transcript 2 (2) --------------------Exon 2.9  PDB: A:517-565 UniProt: 540-588        -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 2.14  PDB: A:765-813 UniProt: 788-836       --------------------------------- Transcript 2 (2)
                 1c4z A 497 NPYLRLKVRRDHIIDDALVRLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYA 846
                                   506       516       526       536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706       716       726       736       746       756       766       776       786       796       806       816       826       836       846

Chain B from PDB  Type:PROTEIN  Length:350
 aligned with UBE3A_HUMAN | Q05086 from UniProtKB/Swiss-Prot  Length:875

    Alignment length:350
                                   529       539       549       559       569       579       589       599       609       619       629       639       649       659       669       679       689       699       709       719       729       739       749       759       769       779       789       799       809       819       829       839       849       859       869
          UBE3A_HUMAN   520 NPYLRLKVRRDHIIDDALVRLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYA 869
               SCOP domains d1c4zb_ B: Ubiquitin-protein ligase E3a (E6ap)                                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee...hhhhhhhhhhhhhhhhhhhhhhh...eee........hhhhhhhhhhhhhhhhhhhhh.eeee....eeee......hhhhhhhhhhhhhhhhhh.........hhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh............eeeee.....eeeee.............hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh.........hhhhhhhhhh.............eee......hhhhhhhhhhhhh.hhhhhhhhhhhhh........hhhhhh.eeeeeee......eeehhh.eeeeee..hhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) ------------------------------------------------R--------------------K-----------------Q---E-------------------------------------------------------------------I----------------R----------------C-----------------------------------------------------------------------I----------------------------------------------------------------L------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------------------------------P------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                    PROSITE ---------------------------HECT  PDB: B:524-846 UniProt: 547-875                                                                                                                                                                                                                                                                                               PROSITE
           Transcript 2 (1) Exon 2.8            ------------------------------------------------Exon 2.10  PDB: B:565-633 UniProt: 588-656                           Exon 2.11  PDB: B:634-688 UniProt: 657-711             Exon 2.12  PDB: B:689-740 UniProt: 712-763          Exon 2.13  PDB: B:741-765-----------------------------------------------Exon 2.15b  PDB: B:813-846         Transcript 2 (1)
           Transcript 2 (2) --------------------Exon 2.9  PDB: B:517-565 UniProt: 540-588        -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 2.14  PDB: B:765-813 UniProt: 788-836       --------------------------------- Transcript 2 (2)
                 1c4z B 497 NPYLRLKVRRDHIIDDALVRLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYA 846
                                   506       516       526       536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706       716       726       736       746       756       766       776       786       796       806       816       826       836       846

Chain C from PDB  Type:PROTEIN  Length:350
 aligned with UBE3A_HUMAN | Q05086 from UniProtKB/Swiss-Prot  Length:875

    Alignment length:350
                                   529       539       549       559       569       579       589       599       609       619       629       639       649       659       669       679       689       699       709       719       729       739       749       759       769       779       789       799       809       819       829       839       849       859       869
          UBE3A_HUMAN   520 NPYLRLKVRRDHIIDDALVRLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYA 869
               SCOP domains d1c4zc_ C: Ubiquitin-protein ligase E3a (E6ap)                                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee...hhhhhhhhhhhhhhhhhhhhhhh...eee........hhhhhhhhhhhhhhhhhhhhh.eeee....eeee......hhhhhhhhhhhhhhhhhh........hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh............eeeee.....eeeee.............hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh.........hhhhhhhhhh.............eee......hhhhhhhhhhhhh.hhhhhhhhhhhhh........hhhhhh.eeeeeee......eeehhh.eeeeee..hhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) ------------------------------------------------R--------------------K-----------------Q---E-------------------------------------------------------------------I----------------R----------------C-----------------------------------------------------------------------I----------------------------------------------------------------L------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------------------------------P------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                    PROSITE ---------------------------HECT  PDB: C:524-846 UniProt: 547-875                                                                                                                                                                                                                                                                                               PROSITE
           Transcript 2 (1) Exon 2.8            ------------------------------------------------Exon 2.10  PDB: C:565-633 UniProt: 588-656                           Exon 2.11  PDB: C:634-688 UniProt: 657-711             Exon 2.12  PDB: C:689-740 UniProt: 712-763          Exon 2.13  PDB: C:741-765-----------------------------------------------Exon 2.15b  PDB: C:813-846         Transcript 2 (1)
           Transcript 2 (2) --------------------Exon 2.9  PDB: C:517-565 UniProt: 540-588        -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 2.14  PDB: C:765-813 UniProt: 788-836       --------------------------------- Transcript 2 (2)
                 1c4z C 497 NPYLRLKVRRDHIIDDALVRLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYA 846
                                   506       516       526       536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706       716       726       736       746       756       766       776       786       796       806       816       826       836       846

Chain D from PDB  Type:PROTEIN  Length:144
 aligned with UB2L3_HUMAN | P68036 from UniProtKB/Swiss-Prot  Length:154

    Alignment length:144
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143    
          UB2L3_HUMAN     4 SRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKY 147
               SCOP domains d1c4zd_ D: Ubiquitin conjugating enzyme, UBC                                                                                                     SCOP domains
               CATH domains 1c4zD00 D:4-147 Ubiquitin Conjugating Enzyme                                                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhh..........eee........eeeeee...........eeeeee..........eeee.............................hhhhhhhhhhhhhhh.......hhhhhhhhhh....hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) -UBIQUITIN_CONJUGAT_2  PDB: D:5-138 UniProt: 5-138                                                                                     --------- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------UBIQUITIN_CONJUG--------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) 1.2a  Exon 1.3  PDB: D:10-41          Exon 1.4  PDB: D:42-104 UniProt: 42-104                        ------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------Exon 1.5  PDB: D:104-147 UniProt: 104-154    Transcript 1 (2)
                 1c4z D   4 SRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKY 147
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1C4Z)

(-) Gene Ontology  (48, 56)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C   (UBE3A_HUMAN | Q05086)
molecular function
    GO:0016874    ligase activity    Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003713    transcription coactivator activity    Interacting selectively and non-covalently with a activating transcription factor and also with the basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between activating transcription factors and the basal transcription machinery.
    GO:0061630    ubiquitin protein ligase activity    Catalysis of the transfer of ubiquitin to a substrate protein via the reaction X-ubiquitin + S -> X + S-ubiquitin, where X is either an E2 or E3 enzyme, the X-ubiquitin linkage is a thioester bond, and the S-ubiquitin linkage is an amide bond: an isopeptide bond between the C-terminal glycine of ubiquitin and the epsilon-amino group of lysine residues in the substrate or, in the linear extension of ubiquitin chains, a peptide bond the between the C-terminal glycine and N-terminal methionine of ubiquitin residues.
    GO:0004842    ubiquitin-protein transferase activity    Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
biological process
    GO:0030521    androgen receptor signaling pathway    Any series of molecular signals generated as a consequence of an androgen binding to its receptor.
    GO:0007420    brain development    The process whose specific outcome is the progression of the brain over time, from its formation to the mature structure. Brain development begins with patterning events in the neural tube and ends with the mature structure that is the center of thought and emotion. The brain is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.).
    GO:0001541    ovarian follicle development    The process whose specific outcome is the progression of the ovarian follicle over time, from its formation to the mature structure.
    GO:0014068    positive regulation of phosphatidylinositol 3-kinase signaling    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
    GO:0031398    positive regulation of protein ubiquitination    Any process that activates or increases the frequency, rate or extent of the addition of ubiquitin groups to a protein.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0060736    prostate gland growth    The increase in size or mass of the prostate gland where the increase in size or mass has the specific outcome of the progression of the gland, from its formation to its mature state.
    GO:0070936    protein K48-linked ubiquitination    A protein ubiquitination process in which a polymer of ubiquitin, formed by linkages between lysine residues at position 48 of the ubiquitin monomers, is added to a protein. K48-linked ubiquitination targets the substrate protein for degradation.
    GO:0051865    protein autoubiquitination    The ubiquitination by a protein of one or more of its own amino acid residues, or residues on an identical protein. Ubiquitination occurs on the lysine residue by formation of an isopeptide crosslink.
    GO:0016567    protein ubiquitination    The process in which one or more ubiquitin groups are added to a protein.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0042752    regulation of circadian rhythm    Any process that modulates the frequency, rate or extent of a circadian rhythm. A circadian rhythm is a biological process in an organism that recurs with a regularity of approximately 24 hours.
    GO:2000058    regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process    Any process that modulates the frequency, rate or extent of protein ubiquitination involved in ubiquitin-dependent protein catabolic process.
    GO:0048511    rhythmic process    Any process pertinent to the generation and maintenance of rhythms in the physiology of an organism.
    GO:0035037    sperm entry    An endocytosis process that results in penetration of the egg shell through the micropyle (a specialized anterior opening in the vitelline envelope) and entry of the entire sperm, including the surrounding plasma membrane and the sperm tail, into the egg cytoplasm. This step in fertilization is seen in Drosophila, where a plasma membrane fusion event between the sperm and the egg does not occur.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.

Chain D   (UB2L3_HUMAN | P68036)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0019899    enzyme binding    Interacting selectively and non-covalently with any enzyme.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003713    transcription coactivator activity    Interacting selectively and non-covalently with a activating transcription factor and also with the basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between activating transcription factors and the basal transcription machinery.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0061631    ubiquitin conjugating enzyme activity    Isoenergetic transfer of ubiquitin from one protein to another via the reaction X-ubiquitin + Y -> Y-ubiquitin + X, where both the X-ubiquitin and Y-ubiquitin linkages are thioester bonds between the C-terminal glycine of ubiquitin and a sulfhydryl side group of a cysteine residue.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
    GO:0097027    ubiquitin-protein transferase activator activity    Increases the activity of a ubiquitin-protein transferase, an enzyme that catalyzes the covalent attachment of ubiquitin to lysine in a substrate protein.
    GO:0004842    ubiquitin-protein transferase activity    Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
biological process
    GO:0044770    cell cycle phase transition    The cell cycle process by which a cell commits to entering the next cell cycle phase.
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
    GO:0006464    cellular protein modification process    The covalent alteration of one or more amino acids occurring in proteins, peptides and nascent polypeptides (co-translational, post-translational modifications) occurring at the level of an individual cell. Includes the modification of charged tRNAs that are destined to occur in a protein (pre-translation modification).
    GO:0071385    cellular response to glucocorticoid stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucocorticoid stimulus. Glucocorticoids are hormonal C21 corticosteroids synthesized from cholesterol with the ability to bind with the cortisol receptor and trigger similar effects. Glucocorticoids act primarily on carbohydrate and protein metabolism, and have anti-inflammatory effects.
    GO:0071383    cellular response to steroid hormone stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a steroid hormone stimulus.
    GO:1903955    positive regulation of protein targeting to mitochondrion    Any process that activates or increases the frequency, rate or extent of protein targeting to mitochondrion.
    GO:0031398    positive regulation of protein ubiquitination    Any process that activates or increases the frequency, rate or extent of the addition of ubiquitin groups to a protein.
    GO:0051443    positive regulation of ubiquitin-protein transferase activity    Any process that activates, maintains or increases the rate of ubiquitin transferase activity.
    GO:0070979    protein K11-linked ubiquitination    A protein ubiquitination process in which ubiquitin monomers are attached to a protein, and then ubiquitin polymers are formed by linkages between lysine residues at position 11 of the ubiquitin monomers. K11-linked polyubiquitination targets the substrate protein for degradation. The anaphase-promoting complex promotes the degradation of mitotic regulators by assembling K11-linked polyubiquitin chains.
    GO:0000209    protein polyubiquitination    Addition of multiple ubiquitin groups to a protein, forming a ubiquitin chain.
    GO:0016567    protein ubiquitination    The process in which one or more ubiquitin groups are added to a protein.
    GO:0042787    protein ubiquitination involved in ubiquitin-dependent protein catabolic process    The process in which a ubiquitin group, or multiple groups, are covalently attached to the target protein, thereby initiating the degradation of that protein.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000151    ubiquitin ligase complex    A protein complex that includes a ubiquitin-protein ligase and enables ubiquitin protein ligase activity. The complex also contains other proteins that may confer substrate specificity on the complex.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1c4z)
 
  Sites
(no "Sites" information available for 1c4z)
 
  Cis Peptide Bonds
    Tyr D:61 - Pro D:62   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1c4z
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  UB2L3_HUMAN | P68036
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  UBE3A_HUMAN | Q05086
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  6.3.2.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
  6.3.2.19
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  105830
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  UB2L3_HUMAN | P68036
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  UBE3A_HUMAN | Q05086
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        UB2L3_HUMAN | P680361fbv 3sqv 3sy2 4q5e 4q5h 5hpt 5udh
        UBE3A_HUMAN | Q050861d5f 1eqx 2kr1 4giz 4xr8

(-) Related Entries Specified in the PDB File

1d5f 1D5F IS E6AP APO STRUCTURE.
1ubq 1UBQ IS THE UBIQUITIN STRUCTURE. UBCH7 TRANSFERS UBIQUITIN TO E6AP AND E6AP TRANSFERS UBIQUITIN TO PROTEIN SUBSTRATE.