|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1B7J) |
Sites (0, 0)| (no "Site" information available for 1B7J) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1B7J) |
Cis Peptide Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1B7J) |
PROSITE Motifs (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1B7J) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:66 aligned with ANP12_ZOAAM | P19614 from UniProtKB/Swiss-Prot Length:66 Alignment length:66 1 | 9 19 29 39 49 59 ANP12_ZOAAM - -NQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVKGYPP 65 SCOP domains d1b7ja_ A: Type III antifreeze protein, AFP III SCOP domains CATH domains 1b7jA00 A:0-65 Type Iii Antifreeze Protein Isoform Hplc 12 CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ----AFP_LIKE PDB: A:4-63 UniProt: 4-63 -- PROSITE Transcript ------------------------------------------------------------------ Transcript 1b7j A 0 ANQASVVANQLIPINTALTLAMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVKGYAA 65 9 19 29 39 49 59
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1B7J) |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (ANP12_ZOAAM | P19614)
|
||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|