1B0V - JenaLib

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	PHE A:2 , CYS A:20 , VAL A:22 , CYS A:24 , PHE A:25 , CYS A:39 , ASN A:40 , CYS A:42 , ALA A:43 , CYS A:45	BINDING SITE FOR RESIDUE SF4 A 107
2	AC2	SOFTWARE	CYS A:8 , LYS A:12 , TYR A:13 , THR A:14 , ASP A:15 , CYS A:16 , LEU A:32 , CYS A:49 , PRO A:50 , ILE A:54	BINDING SITE FOR RESIDUE F3S A 108
3	AC3	SOFTWARE	PHE B:202 , CYS B:220 , VAL B:222 , CYS B:224 , PHE B:225 , CYS B:239 , ASN B:240 , CYS B:242 , ALA B:243 , CYS B:245	BINDING SITE FOR RESIDUE SF4 B 307
4	AC4	SOFTWARE	CYS B:208 , LYS B:212 , TYR B:213 , THR B:214 , ASP B:215 , CYS B:216 , LEU B:232 , CYS B:249 , PRO B:250	BINDING SITE FOR RESIDUE F3S B 308
5	AC5	SOFTWARE	PHE C:402 , CYS C:420 , VAL C:422 , CYS C:424 , PHE C:425 , ILE C:434 , CYS C:439 , ASN C:440 , CYS C:442 , ALA C:443 , CYS C:445	BINDING SITE FOR RESIDUE SF4 C 507
6	AC6	SOFTWARE	CYS C:408 , TYR C:413 , THR C:414 , ASP C:415 , CYS C:416 , LEU C:432 , CYS C:449 , ILE C:454	BINDING SITE FOR RESIDUE F3S C 508
7	AC7	SOFTWARE	PHE D:602 , CYS D:620 , VAL D:622 , CYS D:624 , PHE D:625 , ILE D:634 , CYS D:639 , ASN D:640 , CYS D:642 , ALA D:643 , CYS D:645	BINDING SITE FOR RESIDUE SF4 D 707
8	AC8	SOFTWARE	CYS D:608 , TYR D:613 , THR D:614 , ASP D:615 , CYS D:616 , LEU D:632 , CYS D:649 , ILE D:654	BINDING SITE FOR RESIDUE F3S D 708

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 8)

Asymmetric Unit (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	4FE4S_FER_2	PS51379	4Fe-4S ferredoxin-type iron-sulfur binding domain profile.	FER1_AZOVI	31-60 1-30	4	A:30-59 B:230-259 C:430-459 D:630-659 -
2	4FE4S_FER_1	PS00198	4Fe-4S ferredoxin-type iron-sulfur binding region signature.	FER1_AZOVI	40-51	4	A:39-50 B:239-250 C:439-450 D:639-650

Biological Unit 1 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	4FE4S_FER_2	PS51379	4Fe-4S ferredoxin-type iron-sulfur binding domain profile.	FER1_AZOVI	31-60 1-30	1	A:30-59 - - - -
2	4FE4S_FER_1	PS00198	4Fe-4S ferredoxin-type iron-sulfur binding region signature.	FER1_AZOVI	40-51	1	A:39-50 - - -

Biological Unit 2 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	4FE4S_FER_2	PS51379	4Fe-4S ferredoxin-type iron-sulfur binding domain profile.	FER1_AZOVI	31-60 1-30	1	- B:230-259 - - -
2	4FE4S_FER_1	PS00198	4Fe-4S ferredoxin-type iron-sulfur binding region signature.	FER1_AZOVI	40-51	1	- B:239-250 - -

Biological Unit 3 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	4FE4S_FER_2	PS51379	4Fe-4S ferredoxin-type iron-sulfur binding domain profile.	FER1_AZOVI	31-60 1-30	1	- - C:430-459 - -
2	4FE4S_FER_1	PS00198	4Fe-4S ferredoxin-type iron-sulfur binding region signature.	FER1_AZOVI	40-51	1	- - C:439-450 -

Biological Unit 4 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	4FE4S_FER_2	PS51379	4Fe-4S ferredoxin-type iron-sulfur binding domain profile.	FER1_AZOVI	31-60 1-30	1	- - - D:630-659 -
2	4FE4S_FER_1	PS00198	4Fe-4S ferredoxin-type iron-sulfur binding region signature.	FER1_AZOVI	40-51	1	- - - D:639-650

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:106
 aligned with FER1_AZOVI | P00214 from UniProtKB/Swiss-Prot  Length:107

    Alignment length:106
                                    11        21        31        41        51        61        71        81        91       101      
           FER1_AZOVI     2 AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER 107
               SCOP domains d1b0va_ A: Ferredoxin                                                                                      SCOP domains
               CATH domains 1b0vA00 A:1-106  [code=3.30.70.20, no name defined]                                                        CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.hhhh.....hhhhhh....eeee..eeee.........hhhhhh....eee.hhhhhhhhhhhhhhhhhhhhh...........hhhhhh...hhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) 4FE4S_FER_2  PDB: -          4FE4S_FER_2  PDB: A:30-59     ----------------------------------------------- PROSITE (1)
                PROSITE (2) --------------------------------------4FE4S_FER_1 -------------------------------------------------------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1b0v A   1 AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECNDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER 106
                                    10        20        30        40        50        60        70        80        90       100

Chain B from PDB  Type:PROTEIN  Length:106
 aligned with FER1_AZOVI | P00214 from UniProtKB/Swiss-Prot  Length:107

    Alignment length:106
                                    11        21        31        41        51        61        71        81        91       101      
           FER1_AZOVI     2 AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER 107
               SCOP domains d1b0vb_ B: Ferredoxin                                                                                      SCOP domains
               CATH domains 1b0vB00 B:201-306  [code=3.30.70.20, no name defined]                                                      CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.hhhh....hhhhhhh....eee....eee.........hhhhhh....eee.hhhhhhhhhhhhhhhhhhhhh...........hhhhhh...hhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) 4FE4S_FER_2  PDB: -          4FE4S_FER_2  PDB: B:230-259   ----------------------------------------------- PROSITE (1)
                PROSITE (2) --------------------------------------4FE4S_FER_1 -------------------------------------------------------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1b0v B 201 AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECNDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER 306
                                   210       220       230       240       250       260       270       280       290       300

Chain C from PDB  Type:PROTEIN  Length:106
 aligned with FER1_AZOVI | P00214 from UniProtKB/Swiss-Prot  Length:107

    Alignment length:106
                                    11        21        31        41        51        61        71        81        91       101      
           FER1_AZOVI     2 AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER 107
               SCOP domains d1b0vc_ C: Ferredoxin                                                                                      SCOP domains
               CATH domains 1b0vC00 C:401-506  [code=3.30.70.20, no name defined]                                                      CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.hhhh....hhhhhhh....eee....eee...................eee.hhhhhhhhhhhhhhhhhhh.............hhhhhh...hhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) 4FE4S_FER_2  PDB: -          4FE4S_FER_2  PDB: C:430-459   ----------------------------------------------- PROSITE (1)
                PROSITE (2) --------------------------------------4FE4S_FER_1 -------------------------------------------------------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1b0v C 401 AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECNDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER 506
                                   410       420       430       440       450       460       470       480       490       500

Chain D from PDB  Type:PROTEIN  Length:106
 aligned with FER1_AZOVI | P00214 from UniProtKB/Swiss-Prot  Length:107

    Alignment length:106
                                    11        21        31        41        51        61        71        81        91       101      
           FER1_AZOVI     2 AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER 107
               SCOP domains d1b0vd_ D: Ferredoxin                                                                                      SCOP domains
               CATH domains 1b0vD00 D:601-706  [code=3.30.70.20, no name defined]                                                      CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.hhhh....hhhhhhh....eee....eee.........hhhhhh....eee.hhhhhhhhhhhhhhhhhhh.............hhhhhh...hhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) 4FE4S_FER_2  PDB: -          4FE4S_FER_2  PDB: D:630-659   ----------------------------------------------- PROSITE (1)
                PROSITE (2) --------------------------------------4FE4S_FER_1 -------------------------------------------------------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1b0v D 601 AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECNDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER 706
                                   610       620       630       640       650       660       670       680       690       700

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (7, 7)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (FER1_AZOVI | P00214)

molecular function
	GO:0051538	3 iron, 4 sulfur cluster binding	Interacting selectively and non-covalently with a 3 iron, 4 sulfur (3Fe-4S) cluster; this cluster consists of three iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands. It is essentially a 4Fe-4S cluster with one iron missing.
	GO:0051539	4 iron, 4 sulfur cluster binding	Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0051536	iron-sulfur cluster binding	Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		F3S	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SF4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1b0v)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1b0v
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FER1_AZOVI \| P00214
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 8)

Sites (8, 8)