1AZZ - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   FIDDLER CRAB COLLAGENASE COMPLEXED TO ECOTIN

Authors :   J. J. Perona, R. J. Fletterick

Date :   24 Nov 97 (Deposition) - 25 Feb 98 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym./Biol. Unit : A,B,C,D

Keywords :   Complex (Serine Protease/Inhibitor), Serine Protease, Inhibitor, Complex, Protease-Substrate Interactions, Collagen (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. J. Perona, C. A. Tsu, C. S. Craik, R. J. Fletterick
Crystal Structure Of An Ecotin-Collagenase Complex Suggests A Model For Recognition And Cleavage Of The Collagen Triple Helix.
Biochemistry V. 36 5381 1997
PubMed-ID: 9154920 | Reference-DOI: 10.1021/BI9617522
(for further references see the PDB file header)

Molecule 1 - COLLAGENASE
	Chains	:	A, B
	EC Number	:	3.4.21.32
	Organism Common	:	ATLANTIC SAND FIDDLER CRAB
	Organism Scientific	:	CELUCA PUGILATOR
	Organism Taxid	:	6772
	Other Details	:	CRAB HEPATOPANCREAS

Molecule 2 - ECOTIN
	Chains	:	C, D
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	562
	Plasmid	:	PTACTAC
	Synonym	:	TRYPSIN INHIBITOR

		1	2	3	4
Asymmetric/Biological Unit	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1AZZ)

(no "Site" information available for 1AZZ)

Asymmetric/Biological Unit

No.	Residues
1	A:42	-	A:58
2	A:168	-	A:182
3	A:191	-	A:220
4	B:42	-	B:58
5	B:168	-	B:182
6	B:191	-	B:220
7	C:50	-	C:87
8	D:50	-	D:87

(no "Cis Peptide Bond" information available for 1AZZ)

(no "SAP(SNP)/Variant" information available for 1AZZ)

Asymmetric/Biological Unit (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRYPSIN_DOM	PS50240	Serine proteases, trypsin domain profile.	COGS_UCAPU	1-223	2	A:16-243 B:16-243
2	TRYPSIN_HIS	PS00134	Serine proteases, trypsin family, histidine active site.	COGS_UCAPU	37-42	2	A:53-58 B:53-58
3	TRYPSIN_SER	PS00135	Serine proteases, trypsin family, serine active site.	COGS_UCAPU	172-183	2	A:189-200 B:189-200

(no "Exon" information available for 1AZZ)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:226
 aligned with COGS_UCAPU | P00771 from UniProtKB/Swiss-Prot  Length:226

    Alignment length:226
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220      
          COGS_UCAPU      1 IVGGVEAVPNSWPHQAALFIDDMYFCGGSLISPEWILTAAHCMDGAGFVDVVLGAHNIREDEATQVTIQSTDFTVHENYNSFVISNDIAVIRLPVPVTLTAAIATVGLPSTDVGVGTVVTPTGWGLPSDSALGISDVLRQVDVPIMSNADCDAVYGIVTDGNICIDSTGGKGTCNGDSGGPLNYNGLTYGITSFGAAAGCEAGYPDAFTRVTYFLDWIQTQTGITP  226
               SCOP domains d1azza_ A: Crab collagenase                                                                                                                                                                                                        SCOP domains
               CATH domains 1azzA01     1azzA02 A:28-120,A:233-246 Trypsin-like serine proteases                                     1azzA01 A:16-27,A:121-232 Trypsin-like serine proteases                                                    1azzA02        CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeee...eeeeeeeee..eeee.hhhh.....eeeee............eeeee..eee.............eeee.........................eeeeee...............eeeeeeee.hhhhhhhh......eeeee.......................eeeee...........eeeee.hhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: A:16-243 UniProt: 1-223                                                                                                                                                                                      --- PROSITE (1)
                PROSITE (2) ------------------------------------TRYPSI---------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER ------------------------------------------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1azz A   16 IVGGVEAVPNSWPHQAALFIDDMYFCGGSLISPEWILTAAHCMDGAGFVDVVLGAHNIREDEATQVTIQSTDFTVHENYNSFVISNDIAVIRLPVPVTLTAAIATVGLPSTDVGVGTVVTPTGWGLPSDSALGISDVLRQVDVPIMSNADCDAVYGIVTDGNICIDSTGGKGTCNGDSGGPLNYNGLTYGITSFGAAAGCEAGYPDAFTRVTYFLDWIQTQTGITP  246
                                    25        35|       46        56     || 64 ||     75        85        95       105       115       125|  ||  137       147       157       167    || 178       188|      197      |211      |220       230       240      
                                              35|                      61A|   66|                                                      125|  ||                                     172|           188A             204|     217A                             
                                               37                       61B    68                                                       127  ||                                      174                             209                                      
                                                                                                                                           130|                                                                                                               
                                                                                                                                            132

Chain B from PDB  Type:PROTEIN  Length:226
 aligned with COGS_UCAPU | P00771 from UniProtKB/Swiss-Prot  Length:226

    Alignment length:226
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220      
          COGS_UCAPU      1 IVGGVEAVPNSWPHQAALFIDDMYFCGGSLISPEWILTAAHCMDGAGFVDVVLGAHNIREDEATQVTIQSTDFTVHENYNSFVISNDIAVIRLPVPVTLTAAIATVGLPSTDVGVGTVVTPTGWGLPSDSALGISDVLRQVDVPIMSNADCDAVYGIVTDGNICIDSTGGKGTCNGDSGGPLNYNGLTYGITSFGAAAGCEAGYPDAFTRVTYFLDWIQTQTGITP  226
               SCOP domains d1azzb_ B: Crab collagenase                                                                                                                                                                                                        SCOP domains
               CATH domains 1azzB01     1azzB02 B:28-120,B:233-246 Trypsin-like serine proteases                                     1azzB01 B:16-27,B:121-232 Trypsin-like serine proteases                                                    1azzB02        CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeee...eeeeeeeee..eeee.hhhh.....eeeee............eeeee.eeee.............eeee.........................eeeeee...............eeeeee...hhhhhhhh......eeee........................eeeee...........eeeeehhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: B:16-243 UniProt: 1-223                                                                                                                                                                                      --- PROSITE (1)
                PROSITE (2) ------------------------------------TRYPSI---------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER ------------------------------------------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1azz B   16 IVGGVEAVPNSWPHQAALFIDDMYFCGGSLISPEWILTAAHCMDGAGFVDVVLGAHNIREDEATQVTIQSTDFTVHENYNSFVISNDIAVIRLPVPVTLTAAIATVGLPSTDVGVGTVVTPTGWGLPSDSALGISDVLRQVDVPIMSNADCDAVYGIVTDGNICIDSTGGKGTCNGDSGGPLNYNGLTYGITSFGAAAGCEAGYPDAFTRVTYFLDWIQTQTGITP  246
                                    25        35|       46        56     || 64 ||     75        85        95       105       115       125|  ||  137       147       157       167    || 178       188|      197      |211      |220       230       240      
                                              35|                      61A|   66|                                                      125|  ||                                     172|           188A             204|     217A                             
                                               37                       61B    68                                                       127  ||                                      174                             209                                      
                                                                                                                                           130|                                                                                                               
                                                                                                                                            132

Chain C from PDB  Type:PROTEIN  Length:137
 aligned with ECOT_ECOLI | P23827 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:137
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       
          ECOT_ECOLI     26 PLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR  162
               SCOP domains d1azzc_ C: Ecotin, trypsin inhibitor                                                                                                      SCOP domains
               CATH domains 1azzC00 C:6-142  [code=2.60.40.550, no name defined]                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhh..........eeeeee..........eeeeeeeeeeeee.........eeeeeee....eeeeeee.................eeeeee.......eee......eeeeee...eeeeeeee........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1azz C    6 PLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR  142
                                    15        25        35        45        55        65        75        85        95       105       115       125       135

Chain D from PDB  Type:PROTEIN  Length:138
 aligned with ECOT_ECOLI | P23827 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:138
                                    34        44        54        64        74        84        94       104       114       124       134       144       154        
          ECOT_ECOLI     25 QPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR  162
               SCOP domains d1azzd_ D: Ecotin, trypsin inhibitor                                                                                                       SCOP domains
               CATH domains 1azzD00 D:5-142  [code=2.60.40.550, no name defined]                                                                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhh..........eeeeee..........eeeeeeeeeeeee.........eeeeeee....eeeeeee.................eeeeee.......eee......eeeeee...eeeeeeee........... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1azz D    5 QPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR  142
                                    14        24        34        44        54        64        74        84        94       104       114       124       134

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Beta Barrel (4804)

Topology: Thrombin, subunit H (1535)

Homologous Superfamily: Trypsin-like serine proteases (1488)

Atlantic sand fiddler crab (Celuca pugilator) (1)

1a	1azzA01	A:16-27,A:121-232
1b	1azzB01	B:16-27,B:121-232
1c	1azzA02	A:28-120,A:233-246
1d	1azzB02	B:28-120,B:233-246

Architecture: Sandwich (5577)

Topology: Immunoglobulin-like (3897)

Homologous Superfamily: [code=2.60.40.550, no name defined] (17)

Atlantic sand fiddler crab (Celuca pugilator) (1)

2a	1azzC00	C:6-142
2b	1azzD00	D:5-142

(no "Pfam Domain" information available for 1AZZ)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (COGS_UCAPU | P00771)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
	GO:0008236	serine-type peptidase activity	Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
	GO:0030574	collagen catabolic process	The proteolytic chemical reactions and pathways resulting in the breakdown of collagen in the extracellular matrix, usually carried out by proteases secreted by nearby cells.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.

Chain C,D (ECOT_ECOLI | P23827)

molecular function
	GO:0030414	peptidase inhibitor activity	Stops, prevents or reduces the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004867	serine-type endopeptidase inhibitor activity	Stops, prevents or reduces the activity of serine-type endopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain; a serine residue (and a histidine residue) are at the active center of the enzyme.
biological process
	GO:0010951	negative regulation of endopeptidase activity	Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
	GO:0010466	negative regulation of peptidase activity	Any process that stops or reduces the rate of peptidase activity, the hydrolysis of peptide bonds within proteins.
cellular component
	GO:0030288	outer membrane-bounded periplasmic space	The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
	GO:0042597	periplasmic space	The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1azz)

	Sites
(no "Sites" information available for 1azz)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1azz)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1azz
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	COGS_UCAPU \| P00771
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	ECOT_ECOLI \| P23827
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.4.21.32
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	COGS_UCAPU \| P00771
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	ECOT_ECOLI \| P23827
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1AZZ)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (8, 8)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 6)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (2, 6)

Pfam Domains (0, 0)

Gene Ontology (13, 13)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File