|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (5, 5)| Asymmetric Unit (5, 5) Biological Unit 1 (4, 8) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (1, 1)
Asymmetric Unit
|
||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1AY2) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1AY2) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1AY2) |
Exons (0, 0)| (no "Exon" information available for 1AY2) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:158 aligned with FMM1_NEIGO | P02974 from UniProtKB/Swiss-Prot Length:165 Alignment length:158 17 27 37 47 57 67 77 87 97 107 117 127 137 147 157 FMM1_NEIGO 8 FTLIELMIVIAIVGILAAVALPAYQDYTARAQVSEAILLAEGQKSAVTEYYLNHGKWPENNTSAGVASPPSDIKGKYVKEVEVKNGVVTATMLSSGVNNEIKGKKLSLWARRENGSVKWFCGQPVTRTDDDTVADAKDGKEIDTKHLPSTCRDNFDAK 165 SCOP domains d1ay2a_ A: Pilin Gc SCOP domains CATH domains -1ay2A00 A:2-158 Glycoprotein, Type 4 Pilin CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1ay2 A 1 fTLIELMIVIAIVGILAAVALPAYQDYTARAQVSEAILLAEGQKSAVTEYYLNHGKWPENNTSAGVASPPSDIKGKYVKEVEVKNGVVTATMLSSGVNNEIKGKKLSLWARRENGSVKWFCGQPVTRTDDDTVADAKDGKEIDTKHLPSTCRDNFDAK 158 | 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 | 1-0A9
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1AY2) |
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A (FMM1_NEIGO | P02974)
|
||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|