1ACF - JenaLib

Title :   ACANTHAMOEBA CASTELLANII PROFILIN IB

Authors :   A. A. Fedorov, K. A. Magnus, M. H. Graupe, E. E. Lattman, T. D. Pollard, S. C. Almo

Date :   29 Jul 94 (Deposition) - 31 Aug 94 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym./Biol. Unit : A

Keywords :   Protein Binding, Profilin, Actin-Binding Protein, Contractile Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. A. Fedorov, K. A. Magnus, M. H. Graupe, E. E. Lattman, T. D. Pollard, S. C. Almo
X-Ray Structures Of Isoforms Of The Actin-Binding Protein Profilin That Differ In Their Affinity For Phosphatidylinositol Phosphates.
Proc. Natl. Acad. Sci. Usa V. 91 8636 1994
PubMed-ID: 8078936 | Reference-DOI: 10.1073/PNAS.91.18.8636
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:125
 aligned with PRO1A_ACACA | P68696 from UniProtKB/Swiss-Prot  Length:126

    Alignment length:125
                                    11        21        31        41        51        61        71        81        91       101       111       121     
          PRO1A_ACACA     2 SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF 126
               SCOP domains d1acfa_ A: Profilin (actin-binding protein)                                                                                   SCOP domains
               CATH domains 1acfA00 A:1-125 Dynein light chain 2a, cytoplasmic                                                                            CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhh.....eeeeee...eeeeee......hhhhhhhhhhhh..hhhhhh.eee..eeeeeeeee..eeeeee..eeeeeeee..eeeeeee.....hhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript
                 1acf A   1 SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGTTLAGAFNNADAIRAGGFDLAGVHYVTLRADDRSIYGKKGSSGVITVKTSKAILVGVYNEKIQPGTAANVVEKLADYLIGQGF 125
                                    10        20        30        40        50        60        70        80        90       100       110       120

Chain A from PDB  Type:PROTEIN  Length:125
 aligned with PRO1B_ACACA | Q95VF7 from UniProtKB/Swiss-Prot  Length:126

    Alignment length:125
                                    11        21        31        41        51        61        71        81        91       101       111       121     
          PRO1B_ACACA     2 SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGTTLAGAFNNADAIRAGGFDLAGVHYVTLRADDRSIYGKKGAAGVITVKTSKAILVGVYNEKIQPGTAANVVEKLADYLIGQGF 126
               SCOP domains d1acfa_ A: Profilin (actin-binding protein)                                                                                   SCOP domains
               CATH domains 1acfA00 A:1-125 Dynein light chain 2a, cytoplasmic                                                                            CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhh.....eeeeee...eeeeee......hhhhhhhhhhhh..hhhhhh.eee..eeeeeeeee..eeeeee..eeeeeeee..eeeeeee.....hhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript
                 1acf A   1 SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGTTLAGAFNNADAIRAGGFDLAGVHYVTLRADDRSIYGKKGSSGVITVKTSKAILVGVYNEKIQPGTAANVVEKLADYLIGQGF 125
                                    10        20        30        40        50        60        70        80        90       100       110       120

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (6, 9)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (PRO1B_ACACA | Q95VF7)

molecular function
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.

Chain A (PRO1A_ACACA | P68696)

molecular function
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0003785	actin monomer binding	Interacting selectively and non-covalently with monomeric actin, also known as G-actin.
biological process
	GO:0030036	actin cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
cellular component
	GO:0015629	actin cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1acf)

	Sites
(no "Sites" information available for 1acf)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1acf)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1acf
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PRO1A_ACACA \| P68696
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	PRO1B_ACACA \| Q95VF7
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description