Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  14-3-3 PROTEIN ZETA BOUND TO PS-RAF259 PEPTIDE
 
Authors :  C. Petosa, S. C. Masters, J. Pohl, B. Wang, H. Fu, R. C. Liddington
Date :  28 Jan 98  (Deposition) - 02 Mar 99  (Release) - 17 Aug 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.60
Chains :  Asym./Biol. Unit :  A,B,P,Q
Keywords :  Signal Transduction, Complex (Signal Transduction-Peptide), Complex (Signal Transduction-Peptide) Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. Petosa, S. C. Masters, L. A. Bankston, J. Pohl, B. Wang, H. Fu, R. C. Liddington
14-3-3Zeta Binds A Phosphorylated Raf Peptide And An Unphosphorylated Peptide Via Its Conserved Amphipathic Groove.
J. Biol. Chem. V. 273 16305 1998
PubMed-ID: 9632691  |  Reference-DOI: 10.1074/JBC.273.26.16305
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 14-3-3 PROTEIN ZETA
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism CommonCATTLE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
    Other DetailsCOMPLEXED WITH PHOSPHOSERINE-CONTAINING PEPTIDE DERIVED FROM RAF
 
Molecule 2 - PS-RAF259 PEPTIDE LSQRQRST(SEP)TPNVHM
    ChainsP, Q
    EngineeredYES

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABPQ

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1SEP2Mod. Amino AcidPHOSPHOSERINE

(-) Sites  (0, 0)

(no "Site" information available for 1A37)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1A37)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Thr P:258 -Sep P:259
2Thr Q:258 -Sep Q:259

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1A37)

(-) PROSITE Motifs  (2, 4)

Asymmetric/Biological Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
11433_1PS00796 14-3-3 proteins signature 1.1433Z_BOVIN41-51
 
  2A:41-51
B:41-51
21433_2PS00797 14-3-3 proteins signature 2.1433Z_BOVIN211-230
 
  2A:213-228
B:213-228

(-) Exons   (5, 10)

Asymmetric/Biological Unit (5, 10)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSBTAT000000002891ENSBTAE00000420037chr14:61615845-61615920761433Z_BOVIN-00--
1.2ENSBTAT000000002892ENSBTAE00000002241chr14:61618572-616188763051433Z_BOVIN1-99992A:1-99 (gaps)
B:1-99 (gaps)
99
99
1.3ENSBTAT000000002893ENSBTAE00000002243chr14:61642607-616427301241433Z_BOVIN100-141422A:100-141 (gaps)
B:100-141 (gaps)
42
42
1.4ENSBTAT000000002894ENSBTAE00000002244chr14:61643492-616436551641433Z_BOVIN141-195552A:141-195 (gaps)
B:141-195 (gaps)
55
55
1.5ENSBTAT000000002895ENSBTAE00000427239chr14:61643737-61643832961433Z_BOVIN196-227322A:196-227 (gaps)
B:196-227 (gaps)
32
32
1.6ENSBTAT000000002896ENSBTAE00000409124chr14:61648076-616481961211433Z_BOVIN228-246192A:228-228
B:228-228
1
1

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:195
 aligned with 1433Z_BOVIN | P63103 from UniProtKB/Swiss-Prot  Length:245

    Alignment length:228
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220        
          1433Z_BOVIN     1 MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLW 228
               SCOP domains d1a37a_ A: zeta isoform                                                                                                                                                                                                              SCOP domains
               CATH domains 1a37A00 A:1-228  [code=1.20.190.20, no name defined]                                                                                                                                                                                 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh..hhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhh.-----.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......--..hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh.--------.hhhhhhhhhhhh.--------.hhhhhhhhh....----------.hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------------1433_1     ---------------------------------------------------------------------------------------------------------------------------------------------------------------1433_2             PROSITE
           Transcript 1 (1) Exon 1.2  PDB: A:1-99 (gaps) UniProt: 1-99                                                         Exon 1.3  PDB: A:100-141 (gaps)           ------------------------------------------------------Exon 1.5  PDB: A:196-227 (gaps) 1 Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------------------------------------------------------------------------------Exon 1.4  PDB: A:141-195 (gaps) UniProt: 141-195       --------------------------------- Transcript 1 (2)
                 1a37 A   1 MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQ-----EKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNA--AESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISK--------IRLGLALNFSVFYY--------ACSLAKTAFDEAIA----------DDSTLIMQLLRDNLTLW 228
                                    10        20        30        40        50        60      |  -  |     80        90       100        |- |     120       130       140       150      |  -     | 170        |-       190       200|        - |     220        
                                                                                             67    73                                 109  |                                          157      166          179      188          201        212                
                                                                                                                                         112                                                                                                                    

Chain B from PDB  Type:PROTEIN  Length:195
 aligned with 1433Z_BOVIN | P63103 from UniProtKB/Swiss-Prot  Length:245

    Alignment length:228
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220        
          1433Z_BOVIN     1 MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLW 228
               SCOP domains d1a37b_ B: zeta isoform                                                                                                                                                                                                              SCOP domains
               CATH domains 1a37B00 B:1-228  [code=1.20.190.20, no name defined]                                                                                                                                                                                 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh..hhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhh.-----.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......--..hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh.--------.hhhhhhhhhhhh.--------.hhhhhhhhh....----------.hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------------1433_1     ---------------------------------------------------------------------------------------------------------------------------------------------------------------1433_2             PROSITE
           Transcript 1 (1) Exon 1.2  PDB: B:1-99 (gaps) UniProt: 1-99                                                         Exon 1.3  PDB: B:100-141 (gaps)           ------------------------------------------------------Exon 1.5  PDB: B:196-227 (gaps) 1 Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------------------------------------------------------------------------------Exon 1.4  PDB: B:141-195 (gaps) UniProt: 141-195       --------------------------------- Transcript 1 (2)
                 1a37 B   1 MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQ-----EKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNA--AESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISK--------IRLGLALNFSVFYY--------ACSLAKTAFDEAIA----------DDSTLIMQLLRDNLTLW 228
                                    10        20        30        40        50        60      |  -  |     80        90       100        |- |     120       130       140       150      |  -     | 170        |-       190       200|        - |     220        
                                                                                             67    73                                 109  |                                          157      166          179      188          201        212                
                                                                                                                                         112                                                                                                                    

Chain P from PDB  Type:PROTEIN  Length:7
                                       
               SCOP domains ------- SCOP domains
               CATH domains ------- CATH domains
               Pfam domains ------- Pfam domains
         Sec.struct. author ....... Sec.struct. author
                 SAPs(SNPs) ------- SAPs(SNPs)
                    PROSITE ------- PROSITE
                 Transcript ------- Transcript
                 1a37 P 256 RSTsTPN 262
                               |   
                             259-SEP

Chain Q from PDB  Type:PROTEIN  Length:7
                                       
               SCOP domains ------- SCOP domains
               CATH domains ------- CATH domains
               Pfam domains ------- Pfam domains
         Sec.struct. author ....... Sec.struct. author
                 SAPs(SNPs) ------- SAPs(SNPs)
                    PROSITE ------- PROSITE
                 Transcript ------- Transcript
                 1a37 Q 256 RSTsTPN 262
                               |   
                               |   
                             259-SEP

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1A37)

(-) Gene Ontology  (14, 14)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (1433Z_BOVIN | P63103)
molecular function
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0019904    protein domain specific binding    Interacting selectively and non-covalently with a specific domain of a protein.
    GO:0019901    protein kinase binding    Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
    GO:0008134    transcription factor binding    Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
    GO:0090168    Golgi reassembly    The reformation of the Golgi following its breakdown and partitioning contributing to Golgi inheritance.
    GO:0051683    establishment of Golgi localization    The directed movement of the Golgi to a specific location.
cellular component
    GO:0072562    blood microparticle    A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0005925    focal adhesion    Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
    GO:0042470    melanosome    A tissue-specific, membrane-bounded cytoplasmic organelle within which melanin pigments are synthesized and stored. Melanosomes are synthesized in melanocyte cells.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SEP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1a37)
 
  Cis Peptide Bonds
    Thr P:258 - Sep P:259   [ RasMol ]  
    Thr Q:258 - Sep Q:259   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1a37
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  1433Z_BOVIN | P63103
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  0164
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  1433Z_BOVIN | P63103
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        1433Z_BOVIN | P631031a38 1a4o 1qja 1qjb 2v7d

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1A37)