1A38 - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Title :   14-3-3 PROTEIN ZETA BOUND TO R18 PEPTIDE

Authors :   C. Petosa, S. C. Masters, J. Pohl, B. Wang, H. Fu, R. C. Liddington

Date :   28 Jan 98 (Deposition) - 02 Mar 99 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.35

Chains :   Asym./Biol. Unit : A,B,P,Q

Keywords :   Signal Transduction, Complex (Signal Transduction/Peptide) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. Petosa, S. C. Masters, L. A. Bankston, J. Pohl, B. Wang, H. Fu, R. C. Liddington
14-3-3Zeta Binds A Phosphorylated Raf Peptide And An Unphosphorylated Peptide Via Its Conserved Amphipathic Groove.
J. Biol. Chem. V. 273 16305 1998
PubMed-ID: 9632691 | Reference-DOI: 10.1074/JBC.273.26.16305
(for further references see the PDB file header)

Molecule 1 - 14-3-3 PROTEIN ZETA
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Common	:	CATTLE
	Organism Scientific	:	BOS TAURUS
	Organism Taxid	:	9913

Molecule 2 - R18 PEPTIDE (PHCVPRDLSWLDLEANMCLP)
	Chains	:	P, Q
	Engineered	:	YES

		1	2	3	4
Asymmetric/Biological Unit	:	A	B	P	Q

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1A38)

(no "Site" information available for 1A38)

(no "SS Bond" information available for 1A38)

(no "Cis Peptide Bond" information available for 1A38)

(no "SAP(SNP)/Variant" information available for 1A38)

Asymmetric/Biological Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	1433_1	PS00796	14-3-3 proteins signature 1.	1433Z_BOVIN	41-51	2	A:41-51 B:41-51
2	1433_2	PS00797	14-3-3 proteins signature 2.	1433Z_BOVIN	211-230	2	A:211-228 B:211-228

Asymmetric/Biological Unit (5, 10)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSBTAT00000000289	1	ENSBTAE00000420037	chr14:61615845-61615920	76	1433Z_BOVIN	-	0	0	-	-
1.2	ENSBTAT00000000289	2	ENSBTAE00000002241	chr14:61618572-61618876	305	1433Z_BOVIN	1-99	99	2	A:1-99 (gaps) B:1-99 (gaps)	99 99
1.3	ENSBTAT00000000289	3	ENSBTAE00000002243	chr14:61642607-61642730	124	1433Z_BOVIN	100-141	42	2	A:100-141 B:100-141	42 42
1.4	ENSBTAT00000000289	4	ENSBTAE00000002244	chr14:61643492-61643655	164	1433Z_BOVIN	141-195	55	2	A:141-195 B:141-195	55 55
1.5	ENSBTAT00000000289	5	ENSBTAE00000427239	chr14:61643737-61643832	96	1433Z_BOVIN	196-227	32	2	A:196-227 (gaps) B:196-227 (gaps)	32 32
1.6	ENSBTAT00000000289	6	ENSBTAE00000409124	chr14:61648076-61648196	121	1433Z_BOVIN	228-246	19	2	A:228-228 B:228-228	1 1

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:216
 aligned with 1433Z_BOVIN | P63103 from UniProtKB/Swiss-Prot  Length:245

    Alignment length:228
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220        
          1433Z_BOVIN     1 MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLW 228
               SCOP domains d1a38a_ A: zeta isoform                                                                                                                                                                                                              SCOP domains
               CATH domains 1a38A00 A:1-228  [code=1.20.190.20, no name defined]                                                                                                                                                                                 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh...hhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhh.-----.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.-------..hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------------1433_1     ---------------------------------------------------------------------------------------------------------------------------------------------------------------1433_2             PROSITE
           Transcript 1 (1) Exon 1.2  PDB: A:1-99 (gaps) UniProt: 1-99                                                         Exon 1.3  PDB: A:100-141 UniProt: 100-141 ------------------------------------------------------Exon 1.5  PDB: A:196-227 (gaps) 1 Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------------------------------------------------------------------------------Exon 1.4  PDB: A:141-195 UniProt: 141-195              --------------------------------- Transcript 1 (2)
                 1a38 A   1 MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQ-----EKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAE-------SYKDSTLIMQLLRDNLTLW 228
                                    10        20        30        40        50        60      |  -  |     80        90       100       110       120       130       140       150       160       170       180       190       200 |     210       220        
                                                                                             67    73                                                                                                                              202     210

Chain B from PDB  Type:PROTEIN  Length:216
 aligned with 1433Z_BOVIN | P63103 from UniProtKB/Swiss-Prot  Length:245

    Alignment length:228
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220        
          1433Z_BOVIN     1 MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLW 228
               SCOP domains d1a38b_ B: zeta isoform                                                                                                                                                                                                              SCOP domains
               CATH domains 1a38B00 B:1-228  [code=1.20.190.20, no name defined]                                                                                                                                                                                 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh...hhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhh.-----.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.-------..hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------------1433_1     ---------------------------------------------------------------------------------------------------------------------------------------------------------------1433_2             PROSITE
           Transcript 1 (1) Exon 1.2  PDB: B:1-99 (gaps) UniProt: 1-99                                                         Exon 1.3  PDB: B:100-141 UniProt: 100-141 ------------------------------------------------------Exon 1.5  PDB: B:196-227 (gaps) 1 Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------------------------------------------------------------------------------Exon 1.4  PDB: B:141-195 UniProt: 141-195              --------------------------------- Transcript 1 (2)
                 1a38 B   1 MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQ-----EKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAE-------SYKDSTLIMQLLRDNLTLW 228
                                    10        20        30        40        50        60      |  -  |     80        90       100       110       120       130       140       150       160       170       180       190       200 |     210       220        
                                                                                             67    73                                                                                                                              202     210

Chain P from PDB  Type:PROTEIN  Length:5
                                     
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author ..... Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                 1a38 P   1 WLDLE   5

Chain Q from PDB  Type:PROTEIN  Length:5
                                     
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author ..... Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                 1a38 Q   1 WLDLE   5

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: alpha-alpha superhelix (690)

Superfamily: 14-3-3 protein (60)

Family: 14-3-3 protein (60)

Protein domain: zeta isoform (10)

Cow (Bos taurus) [TaxId: 9913] (3)

1a	d1a38a_	A:
1b	d1a38b_	B:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Delta-Endotoxin; domain 1 (33)

Homologous Superfamily: [code=1.20.190.20, no name defined] (28)

Cattle (Bos taurus) (3)

1a	1a38A00	A:1-228
1b	1a38B00	B:1-228

(no "Pfam Domain" information available for 1A38)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (1433Z_BOVIN | P63103)

molecular function
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0019904	protein domain specific binding	Interacting selectively and non-covalently with a specific domain of a protein.
	GO:0019901	protein kinase binding	Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
	GO:0031625	ubiquitin protein ligase binding	Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
	GO:0090168	Golgi reassembly	The reformation of the Golgi following its breakdown and partitioning contributing to Golgi inheritance.
	GO:0051683	establishment of Golgi localization	The directed movement of the Golgi to a specific location.
cellular component
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0042470	melanosome	A tissue-specific, membrane-bounded cytoplasmic organelle within which melanin pigments are synthesized and stored. Melanosomes are synthesized in melanocyte cells.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1a38)

	Sites
(no "Sites" information available for 1a38)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1a38)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1a38
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	1433Z_BOVIN \| P63103
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	0164
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	1433Z_BOVIN \| P63103
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	1433Z_BOVIN \| P63103	:	1a37 1a4o 1qja 1qjb 2v7d

(no "Related Entries Specified in the PDB File" available for 1A38)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 4)

Exons (5, 10)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (14, 14)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File