1A17 - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   TETRATRICOPEPTIDE REPEATS OF PROTEIN PHOSPHATASE 5

Authors :   A. K. Das, P. T. W. Cohen, D. Barford

Date :   23 Dec 97 (Deposition) - 29 Apr 98 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.45

Chains :   Asym. Unit : A
Biol. Unit 1: A  (4x)
Biol. Unit 2: A  (2x)

Keywords :   Hydrolase, Phosphatase, Protein-Protein Interactions, Tpr, Super- Helix (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. K. Das, P. W. Cohen, D. Barford
The Structure Of The Tetratricopeptide Repeats Of Protein Phosphatase 5: Implications For Tpr-Mediated Protein-Protei Interactions.
Embo J. V. 17 1192 1998
PubMed-ID: 9482716 | Reference-DOI: 10.1093/EMBOJ/17.5.1192

Molecule 1 - SERINE/THREONINE PROTEIN PHOSPHATASE 5
	Chains	:	A
	EC Number	:	3.1.3.16
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Gene	:	PPP5
	Expression System Plasmid	:	PT7.7
	Expression System Strain	:	PT7.7
	Expression System Taxid	:	562
	Expression System Tissue	:	BRAIN
	Fragment	:	PROTEIN INTERACTING DOMAIN
	Gene	:	PPP5
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TETRATRICOPEPTIDE, TRP
	Tissue	:	BRAIN

		1
Asymmetric Unit	:	A
Biological Unit 1 (4x)	:	A
Biological Unit 2 (2x)	:	A

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 2)

No.	Name	Count	Type	Full Name
1	SO4	2	Ligand/Ion	SULFATE ION

Biological Unit 1 (1, 8)

No.	Name	Count	Type	Full Name
1	SO4	8	Ligand/Ion	SULFATE ION

Biological Unit 2 (1, 4)

No.	Name	Count	Type	Full Name
1	SO4	4	Ligand/Ion	SULFATE ION

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	LYS A:97 , TYR A:100 , ARG A:101 , MET A:170 , THR A:171 , HOH A:268 , HOH A:281 , HOH A:301 , HOH A:308	BINDING SITE FOR RESIDUE SO4 A 256
2	AC2	SOFTWARE	LYS A:111 , PHE A:112 , ARG A:113 , ALA A:114 , HOH A:302 , HOH A:303 , HOH A:320	BINDING SITE FOR RESIDUE SO4 A 257

(no "SS Bond" information available for 1A17)

Asymmetric Unit

No.	Residues
1	Pro A:19	-	Pro A:20

(no "SAP(SNP)/Variant" information available for 1A17)

Asymmetric Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TPR	PS50005	TPR repeat profile.	PPP5_HUMAN	28-61 62-95 96-129	3	A:28-61 A:62-95 A:96-129
2	TPR_REGION	PS50293	TPR repeat region circular profile.	PPP5_HUMAN	28-129	1	A:28-129

Biological Unit 1 (2, 16)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TPR	PS50005	TPR repeat profile.	PPP5_HUMAN	28-61 62-95 96-129	12	A:28-61 A:62-95 A:96-129
2	TPR_REGION	PS50293	TPR repeat region circular profile.	PPP5_HUMAN	28-129	4	A:28-129

Biological Unit 2 (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TPR	PS50005	TPR repeat profile.	PPP5_HUMAN	28-61 62-95 96-129	6	A:28-61 A:62-95 A:96-129
2	TPR_REGION	PS50293	TPR repeat region circular profile.	PPP5_HUMAN	28-129	2	A:28-129

Asymmetric Unit (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000012443	1a	ENSE00001134741	chr19:46850251-46850474	224	PPP5_HUMAN	1-41	41	1	A:19-41	23
1.2b	ENST00000012443	2b	ENSE00001656217	chr19:46857005-46857246	242	PPP5_HUMAN	41-121	81	1	A:41-121	81
1.3b	ENST00000012443	3b	ENSE00001774243	chr19:46878861-46879008	148	PPP5_HUMAN	122-171	50	1	A:122-171	50
1.4a	ENST00000012443	4a	ENSE00001752760	chr19:46879710-46879831	122	PPP5_HUMAN	171-211	41	1	A:171-177	7
1.5f	ENST00000012443	5f	ENSE00001235477	chr19:46886668-46886733	66	PPP5_HUMAN	212-233	22	0	-	-
1.5h	ENST00000012443	5h	ENSE00000714122	chr19:46887037-46887135	99	PPP5_HUMAN	234-266	33	0	-	-
1.6b	ENST00000012443	6b	ENSE00000714127	chr19:46888061-46888166	106	PPP5_HUMAN	267-302	36	0	-	-
1.7c	ENST00000012443	7c	ENSE00000714132	chr19:46890350-46890492	143	PPP5_HUMAN	302-349	48	0	-	-
1.8a	ENST00000012443	8a	ENSE00000714135	chr19:46890623-46890710	88	PPP5_HUMAN	350-379	30	0	-	-
1.8e	ENST00000012443	8e	ENSE00000714138	chr19:46891665-46891705	41	PPP5_HUMAN	379-392	14	0	-	-
1.8g	ENST00000012443	8g	ENSE00000714141	chr19:46891810-46891988	179	PPP5_HUMAN	393-452	60	0	-	-
1.9a	ENST00000012443	9a	ENSE00000714144	chr19:46893308-46893389	82	PPP5_HUMAN	452-479	28	0	-	-
1.9h	ENST00000012443	9h	ENSE00001510079	chr19:46893541-46894109	569	PPP5_HUMAN	480-499	20	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:159
 aligned with PPP5_HUMAN | P53041 from UniProtKB/Swiss-Prot  Length:499

    Alignment length:159
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168         
           PPP5_HUMAN    19 PPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYS 177
               SCOP domains d1a17a_ A: Protein phosphatase 5                                                                                                                                SCOP domains
               CATH domains 1a17A00 A:19-177  [code=1.25.40.10, no name defined]                                                                                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---------TPR  PDB: A:28-61 UniProt: 28-61  TPR  PDB: A:62-95 UniProt: 62-95  TPR  PDB: A:96-129 UniProt: 96-129------------------------------------------------ PROSITE (1)
                PROSITE (2) ---------TPR_REGION  PDB: A:28-129 UniProt: 28-129                                                             ------------------------------------------------ PROSITE (2)
           Transcript 1 (1) Exon 1.1a  PDB: A:19-41--------------------------------------------------------------------------------Exon 1.3b  PDB: A:122-171 UniProt: 122-171        ------ Transcript 1 (1)
           Transcript 1 (2) ----------------------Exon 1.2b  PDB: A:41-121 UniProt: 41-121                                         -------------------------------------------------1.4a    Transcript 1 (2)
                 1a17 A  19 PPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYS 177
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: alpha-alpha superhelix (690)

Superfamily: TPR-like (83)

Family: Tetratricopeptide repeat (TPR) (47)

Protein domain: Protein phosphatase 5 (3)

Human (Homo sapiens) [TaxId: 9606] (3)

d1a17a_

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Alpha Horseshoe (399)

Topology: Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat (320)

Homologous Superfamily: [code=1.25.40.10, no name defined] (42)

Human (Homo sapiens) (17)

1a17A00

A:19-177

(no "Pfam Domain" information available for 1A17)

Asymmetric Unit(hide GO term definitions)

Chain A (PPP5_HUMAN | P53041)

molecular function
	GO:0043531	ADP binding	Interacting selectively and non-covalently with ADP, adenosine 5'-diphosphate.
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0001965	G-protein alpha-subunit binding	Interacting selectively and non-covalently with a G-protein alpha subunit. The alpha subunit binds a guanine nucleotide.
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0031072	heat shock protein binding	Interacting selectively and non-covalently with a heat shock protein, any protein synthesized or activated in response to heat shock.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0008017	microtubule binding	Interacting selectively and non-covalently with microtubules, filaments composed of tubulin monomers.
	GO:0004721	phosphoprotein phosphatase activity	Catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate. Together with protein kinases, these enzymes control the state of phosphorylation of cell proteins and thereby provide an important mechanism for regulating cellular activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004722	protein serine/threonine phosphatase activity	Catalysis of the reaction: protein serine phosphate + H2O = protein serine + phosphate, and protein threonine phosphate + H2O = protein threonine + phosphate.
	GO:0004871	signal transducer activity	Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
biological process
	GO:0006281	DNA repair	The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
	GO:0000165	MAPK cascade	An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
	GO:0071276	cellular response to cadmium ion	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cadmium (Cd) ion stimulus.
	GO:0070301	cellular response to hydrogen peroxide	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hydrogen peroxide (H2O2) stimulus.
	GO:0016576	histone dephosphorylation	The modification of histones by removal of phosphate groups.
	GO:0060548	negative regulation of cell death	Any process that decreases the rate or frequency of cell death. Cell death is the specific activation or halting of processes within a cell so that its vital functions markedly cease, rather than simply deteriorating gradually over time, which culminates in cell death.
	GO:1901215	negative regulation of neuron death	Any process that stops, prevents or reduces the frequency, rate or extent of neuron death.
	GO:0001933	negative regulation of protein phosphorylation	Any process that stops, prevents or reduces the rate of addition of phosphate groups to amino acids within a protein.
	GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
	GO:2000324	positive regulation of glucocorticoid receptor signaling pathway	Any process that activates or increases the frequency, rate or extent of glucocorticoid receptor signaling pathway.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
	GO:0051291	protein heterooligomerization	The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers that are not all identical. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
	GO:0051259	protein oligomerization	The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers; protein oligomers may be composed of different or identical monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
	GO:0010288	response to lead ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lead ion stimulus.
	GO:0043278	response to morphine	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a morphine stimulus. Morphine is an opioid alkaloid, isolated from opium, with a complex ring structure.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0071944	cell periphery	The part of a cell encompassing the cell cortex, the plasma membrane, and any external encapsulating structures.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0043231	intracellular membrane-bounded organelle	Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0043005	neuron projection	A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
	GO:0043025	neuronal cell body	The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0043204	perikaryon	The portion of the cell soma (neuronal cell body) that excludes the nucleus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:1990635	proximal dendrite	That part of the dendrite closest to the cell body of the neuron.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Pro A:19 - Pro A:20	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1a17
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PPP5_HUMAN \| P53041
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.16
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PPP5_HUMAN \| P53041
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1A17)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 4)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (44, 44)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File