Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF MYOSIN VIIA IQ5-SAH IN COMPLEX WITH APO-CAM
 
Authors :  J. Li, Y. Chen, Y. Deng, Q. Lu, M. Zhang
Date :  08 Dec 16  (Deposition) - 07 Jun 17  (Release) - 07 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,C  (1x)
Biol. Unit 2:  B,D  (1x)
Keywords :  Molecular Motor, Calcium Signaling, Protein Complex, Calmodulin, Motor Protein-Calcium Binding Protein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Li, Y. Chen, Y. Deng, I. C. Unarta, Q. Lu, X. Huang, M. Zhang
Ca(2+)-Induced Rigidity Change Of The Myosin Viia Iq Motif-Single Alpha Helix Lever Arm Extension
Structure V. 25 579 2017
PubMed-ID: 28262393  |  Reference-DOI: 10.1016/J.STR.2017.02.002

(-) Compounds

Molecule 1 - CALMODULIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 2-149
    Gene: CALM1, CALM, CAM, CAM1, CALM2, CAM2, CAMB, CALM3, CALML2, CAM3, CAMC, CAMIII
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: CAM
 
Molecule 2 - UNCONVENTIONAL MYOSIN-VIIA
    Chains: C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 834-935
    Gene: MYO7A, MYO7
    Organism Common: MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A C 
Biological Unit 2 (1x):  B D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5WSU)

(-) Sites  (0, 0)

(no "Site" information available for 5WSU)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5WSU)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5WSU)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5WSU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5WSU)

(-) Exons   (0, 0)

(no "Exon" information available for 5WSU)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:140
                                                                                                                                                                            
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh...eeehhhhhhhhhhh....hhhhhhhhhhhh....eeehhhhhhhhhhh....hhhhhhhhhh.......eeehhhhhhhhhhh....hhhhhhhhhhhhhhhh..eeehhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5wsu A   2 DQLTEEQIAEFKEAFSLFGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDANGTIDFPEFLTMMARKMKDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 148
                                    11       |24        34        44        54  ||    66        76 ||     88        98       108       118       128       138       148
                                            19|                                57|                78|                                                                   
                                             23                                 60                 81                                                                   


Chain B from PDB  Type:PROTEIN  Length:134
                                                                                                                                                                      
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhh........hhhhhhhhhhhh....hhhhhhhhhhh.....hhhhhhhhhhhh....hhhhhhhhhhhh.....eeehhhhhhhhhhh....hhhhhhhhhhh...eeehhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5wsu B   4 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVNGTIDFPEFLTMMARKMKDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADGQVNYEEFVQMMTA 147
                                    13        23        33        43        53 ||     67        77|       89        99       109       119       133       143    
                                                                              55|               77|                                             128|              
                                                                               60                80                                              133              


Chain C from PDB  Type:PROTEIN  Length:90
                                                                                                                          
               SCOP domains ------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------ Transcript
                 5wsu C 762 GSRHRLWAVITVQAYARGMIARRLHRRLRVEYQRRLEAERMRLAEEEKLRKEMSAKKAKEEAERKHQERLAQLAREDAERELKEKEEARR 851
                                   771       781       791       801       811       821       831       841       851


Chain D from PDB  Type:PROTEIN  Length:91
                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                 5wsu D 760 GPGSRHRLWAVITVQAYARGMIARRLHRRLRVEYQRRLEAERMRLAEEEKLRKEMSAKKAKEEAERKHQERLAQLAREDAERELKEKEEAR 850
                                   769       779       789       799       809       819       829       839       849
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5WSU)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5WSU)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5WSU)

(-) Gene Ontology  (53, 53)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5wsu)
 
  Sites
(no "Sites" information available for 5wsu)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5wsu)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5wsu
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CALM1_HUMAN | P0DP23
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM2_HUMAN | P0DP24
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM3_HUMAN | P0DP25
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  MYO7A_MOUSE | P97479
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CALM1_HUMAN | P0DP23
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM2_HUMAN | P0DP24
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM3_HUMAN | P0DP25
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  MYO7A_MOUSE | P97479
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CALM1_HUMAN | P0DP23: 1aji 1cdl 1cll 1cm1 1cm4 1ctr 1deg 1iwq 1j7o 1j7p 1k90 1k93 1l7z 1lvc 1nkf 1pk0 1qiv 1qiw 1s26 1sk6 1sw8 1up5 1wrz 1xfu 1xfv 1xfw 1xfx 1xfy 1xfz 1y6w 1yr5 1yrt 1yru 1zot 1zuz 2be6 2f3y 2f3z 2hf5 2i08 2jzi 2k0e 2k0f 2k0j 2k61 2kne 2kug 2kuh 2l53 2l7l 2lgf 2ll6 2ll7 2lqc 2lqp 2lv6 2m0j 2m0k 2m55 2mg5 2n27 2n6a 2n77 2n8j 2r28 2v01 2v02 2vay 2w73 2wel 2x0g 2y4v 3bya 3cln 3dve 3dvj 3dvk 3dvm 3evv 3ewt 3ewv 3g43 3hr4 3j41 3o77 3o78 3oxq 3sui 3uct 3ucw 3ucy 4bw7 4bw8 4byf 4dck 4djc 4gow 4jpz 4jq0 4l79 4lzx 4m1l 4ovn 4q57 4q5u 4umo 4upu 4v0c 5coc 5dbr 5dow 5dsu 5ggm 5i0i 5j03 5j8h 5k7l 5k8q 5vms 5wsv
        CALM2_HUMAN | P0DP24: 1aji 1cdl 1cll 1cm1 1cm4 1ctr 1deg 1iwq 1j7o 1j7p 1k90 1k93 1l7z 1lvc 1nkf 1pk0 1qiv 1qiw 1s26 1sk6 1sw8 1up5 1xfu 1xfv 1xfw 1xfx 1xfy 1xfz 1y6w 1yr5 1yrt 1yru 1zot 1zuz 2be6 2f3y 2f3z 2hf5 2jzi 2k0e 2k0f 2k0j 2k61 2kne 2kug 2kuh 2l53 2lgf 2ll6 2ll7 2lqc 2lqp 2lv6 2m0j 2m0k 2m55 2mg5 2n27 2n6a 2n77 2n8j 2r28 2v01 2v02 2vay 2w73 2wel 2x0g 2y4v 3bya 3cln 3dve 3dvj 3dvk 3dvm 3ewt 3ewv 3g43 3hr4 3j41 3oxq 3sui 3uct 3ucw 3ucy 4bw7 4bw8 4byf 4dck 4djc 4gow 4jpz 4jq0 4l79 4lzx 4m1l 4ovn 4q57 4q5u 4umo 4upu 4v0c 5coc 5dbr 5dow 5dsu 5ggm 5i0i 5j03 5j8h 5k7l 5k8q 5vms 5wsv
        CALM3_HUMAN | P0DP25: 1aji 1cdl 1cll 1cm1 1cm4 1ctr 1deg 1iwq 1j7o 1j7p 1k90 1k93 1l7z 1lvc 1nkf 1pk0 1qiv 1qiw 1s26 1sk6 1sw8 1up5 1xfu 1xfv 1xfw 1xfx 1xfy 1xfz 1y6w 1yr5 1yrt 1yru 1zot 1zuz 2be6 2f3y 2f3z 2hf5 2jzi 2k0e 2k0f 2k0j 2k61 2kne 2kug 2kuh 2l53 2lgf 2ll6 2ll7 2lqc 2lqp 2lv6 2m0j 2m0k 2m55 2mg5 2n27 2n6a 2n77 2n8j 2r28 2v01 2v02 2vay 2w73 2wel 2x0g 2y4v 3bya 3cln 3dve 3dvj 3dvk 3dvm 3ewt 3ewv 3g43 3hr4 3j41 3oxq 3sui 3uct 3ucw 3ucy 4bw7 4bw8 4byf 4dck 4djc 4gow 4jpz 4jq0 4l79 4lzx 4m1l 4ovn 4q57 4q5u 4umo 4upu 4v0c 5coc 5dbr 5dow 5dsu 5ggm 5i0i 5j03 5j8h 5k7l 5k8q 5vms 5wsv
        MYO7A_MOUSE | P97479: 3pvl 5wst 5wsv

(-) Related Entries Specified in the PDB File

5wst 5wsv