Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE CURACIN BIOSYNTHETIC PATHWAY HMG SYNTHASE IN COMPLEX WITH HOLO DONOR-ACP
 
Authors :  F. P. Maloney, J. L. Smith
Date :  02 Jul 16  (Deposition) - 31 Aug 16  (Release) - 21 Sep 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Hmg Synthase, Acyl Carrier Protein, Enzyme-Acp Complex, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  F. P. Maloney, L. Gerwick, W. H. Gerwick, D. H. Sherman, J. L. Smith
Anatomy Of The Beta-Branching Enzyme Of Polyketide Biosynthesis And Its Interaction With An Acyl-Acp Substrate
Proc. Natl. Acad. Sci. Usa V. 113 10316 2016
PubMed-ID: 27573844  |  Reference-DOI: 10.1073/PNAS.1607210113

(-) Compounds

Molecule 1 - CURD
    ChainsA
    EC Number2.3.3.10
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPMCSG7
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneLYNGBM3L_74540
    MutationYES
    Organism ScientificMOOREA PRODUCENS 3L
    Organism Taxid489825
    SynonymHYDROXYMETHYLGLUTARYL-COA SYNTHASE
 
Molecule 2 - CURB
    ChainsB
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPMCSG7
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneCURB
    Organism ScientificLYNGBYA MAJUSCULA
    Organism Taxid158786

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric/Biological Unit (2, 3)
No.NameCountTypeFull Name
1PNS1Ligand/Ion4'-PHOSPHOPANTETHEINE
2SO42Ligand/IonSULFATE ION

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:353 , LYS A:410 , LYS A:415binding site for residue SO4 A 501
2AC2SOFTWARETYR A:231 , VAL A:235 , ARG A:320 , HOH A:840binding site for residue SO4 A 502
3AC3SOFTWAREARG A:33 , LEU A:37 , MET A:39 , PHE A:163 , PRO A:166 , SER A:167 , SER A:216 , MET A:256 , SER B:39 , ARG B:42 , HOH B:206 , HOH B:208binding site for residue PNS B 100

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5KP7)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Gly A:329 -Cys A:330

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5KP7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5KP7)

(-) Exons   (0, 0)

(no "Exon" information available for 5KP7)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:410
                                                                                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeee...eeeehhhhhhhh...hhhhhhh...eee......hhhhhhhhhhhhhhhhhhhhhhhheeeeeee..........hhhhhhhhhh.....eeeee.hhhhhhhhhhhhhhhhhhhh.....eeeeeeee........hhhhh.....eeeeeeee.....eeeeeeeeeeee.....ee.......eehhhhhhhhhhhhhhhhhhhhhhhh..........eeee...hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.....eeeeeeeee...eeeeeeeeehhhhhhhhhh.hhhhhhhh.ee.hhhhhhhhhhhhhhhh.....ee.....hhhhhhhhh....eeeeeee..eeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5kp7 A   2 QQVGIEALSVYGGAAQLELRKLAQARQLDISRFDNLMMKEKAVSLPYEDPVSYAVNAAKPIIDRLSDADKQRIEMVITCSESGIDFGKSMSTYIQEYLGLSRNCRMFELKQACYSGTAGLQMAINLILSQTFPGAKALVIATDISRFLVYDWSFAEPSSGAGAVALLVSDTPHIFQIDVGCNGYYGYEVMDTCRPNPDSEAGDADLSLLSYLDCCENAYRHYQNRVEGVDYRESFDYLSFHTPFGGMVKGAHRNMMRRLKRAKPAEIEADFQRRVMPGLVYCQQVGNIMGATLFLSLASTIDNGDFSTPRRIGMFSYGSGCCSEFYSGVVTPEGAAIAAQQGISAQLADRYSLSMEEYEQLLYHSSAVAFGTRNVTLDYQLFPGVWKKIAGKGRLVLKAIKEFHRKYEWV 419
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419
                                                                                                                                                                              150|                                                                                                                                                                                                                                                                    
                                                                                                                                                                               159                                                                                                                                                                                                                                                                    

Chain B from PDB  Type:PROTEIN  Length:79
                                                                                                               
               SCOP domains ------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhh....hhhhhh...hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------- Transcript
                 5kp7 B   1 MSKEQVLKIIKKYTREIAPELEDSPLEPTDSLKKLGIDSVNRAEIIMMVMEDLSLNIPRIELAGAKNIGELADLFAAKL  79
                                    10        20        30        40        50        60        70         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5KP7)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5KP7)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5KP7)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PNS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:329 - Cys A:330   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5kp7
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  F4Y432_9CYAN | F4Y432
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
  Q6DNF1_9CYAN | Q6DNF1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.3.3.10
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  F4Y432_9CYAN | F4Y432
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q6DNF1_9CYAN | Q6DNF1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        F4Y432_9CYAN | F4Y4325kp5 5kp6 5kp8
        Q6DNF1_9CYAN | Q6DNF15kp6 5kp8

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5KP7)