Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  PYOCYANIN DEMETHYLASE
 
Authors :  K. C. Costa, N. R. Glasser, D. K. Newman
Date :  18 May 16  (Deposition) - 07 Dec 16  (Release) - 25 Jan 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Demethylase Phenazine, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. C. Costa, N. R. Glasser, S. J. Conway, D. K. Newman
Pyocyanin Degradation By A Tautomerizing Demethylase Inhibits Pseudomonas Aeruginosa Biofilms.
Science V. 355 170 2017
PubMed-ID: 27940577  |  Reference-DOI: 10.1126/SCIENCE.AAG3180

(-) Compounds

Molecule 1 - PYOCYANIN DEMETHYLASE
    Chains: A, B, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Taxid: 469008
    Gene: MFORT_14352
    Organism Scientific: MYCOBACTERIUM FORTUITUM SUBSP. FORTUITUM DSM 46621 ATCC 6841
    Organism Taxid: 1214102

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 6)

Asymmetric/Biological Unit (2, 6)
No.NameCountTypeFull Name
16QF3Ligand/IonPHENAZIN-1-OL
2CA3Ligand/IonCALCIUM ION

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:68 , PHE A:70 , CYS A:88 , HIS A:121 , PHE A:126 , TYR A:156binding site for residue 6QF A 201
2AC2SOFTWAREASP A:56 , PHE A:57 , LYS A:59 , GLY A:61 , ASP A:63 , ASP A:66binding site for residue CA A 202
3AC3SOFTWAREASP B:68 , PHE B:70 , CYS B:88 , HIS B:121 , PHE B:126 , TYR B:156binding site for residue 6QF B 201
4AC4SOFTWAREASP B:56 , PHE B:57 , LYS B:59 , GLY B:61 , ASP B:63 , ASP B:66binding site for residue CA B 202
5AC5SOFTWAREASP C:68 , PHE C:70 , CYS C:88 , HIS C:121 , VAL C:149 , GLU C:154 , TYR C:156binding site for residue 6QF C 201
6AC6SOFTWAREASP C:56 , PHE C:57 , LYS C:59 , GLY C:61 , ASP C:63 , ASP C:66binding site for residue CA C 202

(-) SS Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1A:88 -A:102
2B:88 -B:102
3C:88 -C:102

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5K21)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5K21)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5K21)

(-) Exons   (0, 0)

(no "Exon" information available for 5K21)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:121
                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeeeeeee...........eeeeeeeeee..eeeeeeeeeeeeeeee..eeeeeeeeeeee..eeeeeeeeee.....eeeeeeee.hhhh..eeeeeee.......eeeeeee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript
                 5k21 A  41 VTMTLDVKNDQVAKHDFGKPGMDVGDMDIFSDILSVDGKQVGYDGGACFFTNVTPDNPMTYCELTIHLDAGEIFARSLTPHTLAPFTMAITGGTGEYANSKGELTVSGVATPDEKYELKLT 161
                                    50        60        70        80        90       100       110       120       130       140       150       160 


Chain B from PDB  Type:PROTEIN  Length:123
                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeeeeeee...........eeeeeeeeee..eeeeeeeeeeeeeee....eeeeeeeeeee..eeeeeeeeee.....eeeeeeee.hhhh..eeeeeee.......eeeeeee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript
                 5k21 B  39 EPVTMTLDVKNDQVAKHDFGKPGMDVGDMDIFSDILSVDGKQVGYDGGACFFTNVTPDNPMTYCELTIHLDAGEIFARSLTPHTLAPFTMAITGGTGEYANSKGELTVSGVATPDEKYELKLT 161
                                    48        58        68        78        88        98       108       118       128       138       148       158   


Chain C from PDB  Type:PROTEIN  Length:122
                                                                                                                                                          
               SCOP domains -------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeeeeeee...........eeeeeeeeee..eeeeeeeeeeeeeee....eeeeeeeeeee..eeeeeeeeee.....eeeeeeee.hhhh...eeeeee.......eeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript
                 5k21 C  41 VTMTLDVKNDQVAKHDFGKPGMDVGDMDIFSDILSVDGKQVGYDGGACFFTNVTPDNPMTYCELTIHLDAGEIFARSLTPHTLAPFTMAITGGTGEYANSKGELTVSGVATPDEKYELKLTK 162
                                    50        60        70        80        90       100       110       120       130       140       150       160
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5K21)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5K21)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5K21)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    6QF  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5k21)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5k21
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  K0V2D8_MYCFO | K0V2D8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  K0V2D8_MYCFO | K0V2D8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5K21)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5K21)