5HKO - JenaLib

Title :   CRYSTAL STRUCTURE OF ABC TRANSPORTER SOLUTE BINDING PROTEIN MSMEG_3598 FROM MYCOBACTERIUM SMEGMATIS STR. MC2 155, TARGET EFI-510969, IN COMPLEX WITH L-SORBITOL

Authors :   Y. Roth, M. W. Vetting, N. F. Al Obaidi, R. Toro, L. L. Morisco, J. Benach S. R. Wasserman, J. A. Gerlt, S. C. Almo, Enzyme Function Initiative

Date :   14 Jan 16 (Deposition) - 03 Feb 16 (Release) - 03 Feb 16 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.20

Chains :   Asym./Biol. Unit : A

Keywords :   Abc Transporter Solute Binding Protein, Enzyme Function Initiative, Efi, Structural Genomics, Solute-Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Roth, M. W. Vetting, N. F. Al Obaidi, R. Toro, L. L. Morisco, J. Benach, J. Koss, S. R. Wasserman, J. A. Gerlt, S. C. Almo, Enzyme Function Initiative (Efi)
Crystal Structure Of Abc Transporter Solute Binding Protein Msmeg_3598 From Mycobacterium Smegmatis Str. Mc2 155, Targe Efi-510969, In Complex With L-Sorbitol
To Be Published
PubMed: search

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (5, 33)

Sites (33, 33)

Asymmetric Unit (33, 33)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	GLU A:50 , GLU A:252 , CL A:416 , CL A:417	binding site for residue ZN A 401
02	AC2	SOFTWARE	ASP A:128 , ASP A:178 , CL A:421 , ACT A:431	binding site for residue ZN A 402
03	AC3	SOFTWARE	GLU A:53 , IMD A:427 , ACT A:432 , HOH A:663	binding site for residue ZN A 403
04	AC4	SOFTWARE	ASP A:218 , ACT A:433 , HOH A:735 , HOH A:736	binding site for residue ZN A 404
05	AC5	SOFTWARE	ASP A:136 , HOH A:724 , HOH A:741 , HOH A:750	binding site for residue ZN A 405
06	AC6	SOFTWARE	GLU A:237 , IMD A:429 , IMD A:430 , HOH A:713	binding site for residue ZN A 406
07	AC7	SOFTWARE	ASP A:337 , THR A:347 , HOH A:659	binding site for residue ZN A 407
08	AC8	SOFTWARE	LYS A:52 , ASP A:56 , ASP A:186 , CL A:418 , CL A:419	binding site for residue ZN A 408
09	AC9	SOFTWARE	ASP A:74 , SER A:76 , HOH A:503 , HOH A:523 , HOH A:653 , HOH A:690	binding site for residue ZN A 409
10	AD1	SOFTWARE	ASP A:200	binding site for residue ZN A 410
11	AD2	SOFTWARE	ASP A:294 , HOH A:744 , HOH A:764	binding site for residue ZN A 411
12	AD3	SOFTWARE	GLU A:170 , CL A:420 , HOH A:504 , HOH A:746	binding site for residue ZN A 412
13	AD4	SOFTWARE	ASP A:43 , ASN A:72 , ASP A:150 , CL A:422 , IMD A:426	binding site for residue ZN A 413
14	AD5	SOFTWARE	ASP A:200 , CL A:423 , CL A:424 , IMD A:428 , HOH A:535 , HOH A:753	binding site for residue ZN A 414
15	AD6	SOFTWARE	GLU A:125 , HOH A:751	binding site for residue ZN A 415
16	AD7	SOFTWARE	GLU A:50 , ARG A:199 , GLU A:252 , ASP A:253 , ZN A:401	binding site for residue CL A 416
17	AD8	SOFTWARE	GLU A:50 , GLU A:252 , ZN A:401	binding site for residue CL A 417
18	AD9	SOFTWARE	ASP A:56 , ASP A:186 , ZN A:408	binding site for residue CL A 418
19	AE1	SOFTWARE	ASP A:56 , LYS A:60 , ASP A:186 , ZN A:408	binding site for residue CL A 419
20	AE2	SOFTWARE	GLU A:170 , ZN A:412 , HOH A:504 , HOH A:746	binding site for residue CL A 420
21	AE3	SOFTWARE	ASP A:128 , ILE A:160 , ASP A:178 , ZN A:402 , ACT A:431	binding site for residue CL A 421
22	AE4	SOFTWARE	ASP A:43 , ASN A:72 , ASN A:73 , ASP A:150 , LYS A:198 , ZN A:413 , IMD A:426 , IMD A:428	binding site for residue CL A 422
23	AE5	SOFTWARE	ASP A:200 , ZN A:414 , CL A:424 , IMD A:426 , IMD A:428	binding site for residue CL A 423
24	AE6	SOFTWARE	ZN A:414 , CL A:423 , IMD A:428 , HOH A:535 , HOH A:707	binding site for residue CL A 424
25	AE7	SOFTWARE	TYR A:42 , ASN A:121 , ALA A:122 , ARG A:173 , TRP A:197 , ASN A:224 , ASP A:249 , GLN A:269 , HOH A:540 , HOH A:561 , HOH A:602 , HOH A:604	binding site for residue 62W A 425
26	AE8	SOFTWARE	ASP A:43 , MET A:44 , GLN A:146 , ASP A:150 , ZN A:413 , CL A:422 , CL A:423 , IMD A:428 , HOH A:675	binding site for residue IMD A 426
27	AE9	SOFTWARE	GLU A:53 , LYS A:183 , GLU A:252 , ARG A:318 , ZN A:403 , ACT A:432	binding site for residue IMD A 427
28	AF1	SOFTWARE	ZN A:414 , CL A:422 , CL A:423 , CL A:424 , IMD A:426 , HOH A:535 , HOH A:761	binding site for residue IMD A 428
29	AF2	SOFTWARE	GLU A:237 , VAL A:296 , ASP A:337 , ZN A:406 , IMD A:430 , HOH A:621 , HOH A:713	binding site for residue IMD A 429
30	AF3	SOFTWARE	ASP A:136 , GLU A:237 , ZN A:406 , IMD A:429	binding site for residue IMD A 430
31	AF4	SOFTWARE	LYS A:111 , ASP A:128 , GLY A:174 , ASP A:178 , LYS A:192 , ZN A:402 , CL A:421 , HOH A:557	binding site for residue ACT A 431
32	AF5	SOFTWARE	GLU A:53 , ARG A:318 , GLN A:319 , ZN A:403 , IMD A:427 , HOH A:663	binding site for residue ACT A 432
33	AF6	SOFTWARE	PRO A:215 , ASP A:218 , ZN A:404	binding site for residue ACT A 433

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:314
                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee...hhhhhhhhhhhhhhhhhh.eeeeeee...hhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhh...eeee..........eeeeehhhhhhhhhhhhhhhhhh..eeeeeee....hhhhhhhhhhhhhhhh....eeeeeeee...hhhhhhhhhhhhhhhhhhhh.eeee.hhhhhhhhhhhhhhh......ee....hhhhhhhhhh.....ee..hhhhhhhhhhhhhhhhhh........ee...ee...hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hko A  34 TKRIGVTVYDMSSFITEGKEGMDTYAKANNIELVWNSANNDVSTQASQVDSLINQGVDAIIVVPVQADSLGPQVASAKSKGIPLLAVNAALETPDLAGNVQPDDVAAGAQEMQMMADRLGGKGNIVILQGPLGGSGEINRGKGIDQVLAKYPDIKVLAKDTANWKRDEAVNKMKNWISSFGPQIDGVVAQNDDMGLGALQALKEAGRTGVPIVGIDGIEDGLNAVKSGDFIGTSLQNGTVELSAGLAVADALVKGEDVKTDPVYVMPAITKDNVDVAIEHVVTERQKFLDGLVELTQQNLKTGDIAYEGIPGQT 347
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (6, 6)

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		62W	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ACT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		IMD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]
		AD2	[ RasMol ]	+environment [ RasMol ]
		AD3	[ RasMol ]	+environment [ RasMol ]
		AD4	[ RasMol ]	+environment [ RasMol ]
		AD5	[ RasMol ]	+environment [ RasMol ]
		AD6	[ RasMol ]	+environment [ RasMol ]
		AD7	[ RasMol ]	+environment [ RasMol ]
		AD8	[ RasMol ]	+environment [ RasMol ]
		AD9	[ RasMol ]	+environment [ RasMol ]
		AE1	[ RasMol ]	+environment [ RasMol ]
		AE2	[ RasMol ]	+environment [ RasMol ]
		AE3	[ RasMol ]	+environment [ RasMol ]
		AE4	[ RasMol ]	+environment [ RasMol ]
		AE5	[ RasMol ]	+environment [ RasMol ]
		AE6	[ RasMol ]	+environment [ RasMol ]
		AE7	[ RasMol ]	+environment [ RasMol ]
		AE8	[ RasMol ]	+environment [ RasMol ]
		AE9	[ RasMol ]	+environment [ RasMol ]
		AF1	[ RasMol ]	+environment [ RasMol ]
		AF2	[ RasMol ]	+environment [ RasMol ]
		AF3	[ RasMol ]	+environment [ RasMol ]
		AF4	[ RasMol ]	+environment [ RasMol ]
		AF5	[ RasMol ]	+environment [ RasMol ]
		AF6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5hko)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	5hko
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	XYPA_MYCS2 \| A0QYB3
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.6.3.17
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description