Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE HUMAN ASTROVIRUS 1 CAPSID PROTEIN SPIKE DOMAIN AT 0.95-A RESOLUTION
 
Authors :  W. Bogdanoff, R. L. York, P. A. Yousefi, S. Haile, S. Tripathi, R. M. Dubo
Date :  20 Nov 15  (Deposition) - 23 Dec 15  (Release) - 24 Feb 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  0.95
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Viral Protein, Capsid Protein, Icosahedral Virus, Beta Barrel (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. L. York, P. A. Yousefi, W. Bogdanoff, S. Haile, S. Tripathi, R. M. Dubois
Structural, Mechanistic, And Antigenic Characterization Of The Human Astrovirus Capsid.
J. Virol. V. 90 2254 2015
PubMed-ID: 26656707  |  Reference-DOI: 10.1128/JVI.02666-15

(-) Compounds

Molecule 1 - STRUCTURAL PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET52B
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: SPIKE DOMAIN (UNP RESIDUES 429-645)
    Organism Common: HASTV-1
    Organism Scientific: HUMAN ASTROVIRUS-1
    Organism Taxid: 12456

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1SO44Ligand/IonSULFATE ION
Biological Unit 1 (1, 8)
No.NameCountTypeFull Name
1SO48Ligand/IonSULFATE ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREALA A:446 , ASN A:447 , ASN A:448 , THR A:529 , ASN A:530 , HOH A:831 , HOH A:873 , HOH A:937binding site for residue SO4 A 701
2AC2SOFTWAREPRO A:460 , SER A:461 , GLN A:548 , TYR A:552 , HOH A:827 , HOH A:885 , HOH A:886binding site for residue SO4 A 702
3AC3SOFTWAREMET A:442 , SER A:443 , SER A:581 , ALA A:599 , MET A:600 , HOH A:824 , HOH A:837 , HOH A:854 , HOH A:876 , HOH A:898binding site for residue SO4 A 703
4AC4SOFTWAREGLY A:505 , GLN A:507 , LYS A:514 , LYS A:612 , THR A:613 , ASN A:614 , THR A:615binding site for residue SO4 A 704

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5EWO)

(-) Cis Peptide Bonds  (1, 2)

Asymmetric Unit
No.Residues
1Ser A:443 -Pro A:444

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5EWO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5EWO)

(-) Exons   (0, 0)

(no "Exon" information available for 5EWO)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:214
                                                                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee..............ee...........eeeeee..eeee...eeeeeeeeee.....ee.........eeee..eeeeeeeeeeeeeeeee..eeeeeeeeeeee...eeeeeeee.ee............ee....eeeeeee....eeeeeeeeeee.....................................eeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ewo A 431 EYKVVLTFGSPMSPNANNKQTWVNKPLDAPSGHYNVKIAKDVDHYLTMQGFTSIASVDWYTIDFQPSEAPAPIKGLQVLVNISKKADVYAVKQFVTAQTNNKHQVTSLFLVKVTTGFQVNNYLSYFYRASATGDATTNLLVRGDTYTAGISFTQGGWYLLTNTSIVDGAMPPGWVWNNVELKTNTAYHMDKGLVHLIMPLPESTQMCYEMLTSI 644
                                   440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5EWO)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5EWO)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5EWO)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5EWO)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ser A:443 - Pro A:444   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ewo
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q82452_HASV1 | Q82452
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q82452_HASV1 | Q82452
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q82452_HASV1 | Q82452: 5ewn

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5EWO)