4ZQP - JenaLib

Title :   CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF THE INOSINE MONOPHOSPHATE DEHYDROGENASE FROM MYCOBACTERIUM TUBERCULOSIS IN THE COMPLEX WITH IMP AND THE INHIBITOR MAD1

Authors :   Y. Kim, M. Makowska-Grzyska, M. Gu, M. Kavitha, L. Hedstrom, W. F. Ander A. Joachimiak, Center For Structural Genomics Of Infectious D (Csgid)

Date :   10 May 15 (Deposition) - 17 Jun 15 (Release) - 08 Feb 17 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym. Unit : A
Biol. Unit 1: A  (4x)

Keywords :   Impdh, Delta Cbs, Mad1, Structural Genomics, Center For Membrane Proteins Of Infectious Diseases, Center For Structural Genomics Of Infectious Diseases, Csgid, Oxidoreductase-Oxidoreductase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Makowska-Grzyska, Y. Kim, S. K. Gorla, Y. Wei, K. Mandapati, M. Zhang, N. Maltseva, G. Modi, H. I. Boshoff, M. Gu, C. Aldrich, G. D. Cuny, L. Hedstrom, A. Joachimiak
Mycobacterium Tuberculosis Impdh In Complexes With Substrates, Products And Antitubercular Compounds.
Plos One V. 10 38976 2015
PubMed-ID: 26440283 | Reference-DOI: 10.1371/JOURNAL.PONE.0138976

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (6, 6)

Sites (6, 6)

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	SER A:83 , MET A:85 , GLY A:338 , SER A:339 , ILE A:340 , CYS A:341 , ASP A:374 , GLY A:375 , GLY A:376 , MET A:395 , GLY A:397 , SER A:398 , TYR A:421 , GLY A:423 , MET A:424 , GLY A:425 , GLU A:458 , GLY A:459 , KP3 A:602 , HOH A:717 , HOH A:744 , HOH A:763 , HOH A:807 , HOH A:828	binding site for residue IMP A 601
2	AC2	SOFTWARE	VAL A:59 , ARG A:108 , VAL A:261 , ASP A:283 , THR A:284 , ALA A:285 , ASN A:289 , ASN A:313 , GLY A:334 , VAL A:335 , GLY A:336 , CYS A:341 , THR A:343 , MET A:424 , GLY A:425 , GLU A:458 , ALA A:483 , GLY A:486 , TYR A:487 , IMP A:601	binding site for residue KP3 A 602
3	AC3	SOFTWARE	GLY A:336 , GLY A:338 , CYS A:341 , GLU A:511 , SER A:512 , HIS A:513	binding site for residue K A 603
4	AC4	SOFTWARE	LEU A:399 , PRO A:524 , TYR A:527 , HOH A:706	binding site for residue PO4 A 604
5	AC5	SOFTWARE	ASP A:48 , GLN A:378 , TYR A:379 , ASP A:382 , LYS A:510 , HIS A:515 , ASP A:516 , HOH A:709 , HOH A:778	binding site for residue GOL A 605
6	AC6	SOFTWARE	ASP A:48 , ASP A:49 , THR A:505 , PRO A:506 , ALA A:507 , LEU A:509 , HOH A:868	binding site for residue PGO A 606

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:354
                                                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..................hhh.eee.......hhhhh...ee.....ee...eee.......hhhhhhhhhhh..eeee....hhhhhhhhhhhhhh......eeee..hhhhhhhhhhhhhhh..eeeee.....hhhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhhh..eeee........hhhhhh....hhhhhhhhhhhhhhhhh..eeee....hhhhhhhhhhh...eeeehhhhhh.......eeee..eeeeeee...hhhhhh.......eeeee...hhhhhhhhhhhhhhhhhhhhh..hhhhhh...eee.hhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4zqp A  28 DPVPTGGDDPHKVAMLGLTFDDVLLLPAASDVVPATADTSSQLTKKIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQAGQVEMVKRSGGLLVGAAVGVGGDAWVRAMMLVDAGVDVLVVDTAHAHNRLVLDMVGKLKSEVGDRVEVVGGNVATRSAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACRPAGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQYKSYRGMGSLGAMRKLVPEGIEGRVPFRGPLSSVIHQLTGGLRAAMGYTGSPTIEVLQQAQFVRITPAGLKESHPHDVAMTVEAPNYYA 528
                                    37        47        57        67        77        87        97       107       117       127|      262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       454       464       474       484       494       504       514       524    
                                                                                                                             127|                                                                                                                                                                               431|                                                                          
                                                                                                                              253                                                                                                                                                                                454

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (13, 13)

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		IMP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		K	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		KP3	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PGO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gly A:312 - Asn A:313	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	4zqp
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	IMDH_MYCTU \| P9WKI7
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.1.1.205
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description