Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PORCINE PANCREATIC ELASTASE (PPE) IN COMPLEX WITH THE NOVEL INHIBITOR JM102
 
Authors :  S. Hofbauer, J. A. Brito, J. Mulchande, P. Nogly, M. Pessanha, R. Moreir M. Archer
Date :  06 Mar 15  (Deposition) - 29 Jun 16  (Release) - 29 Jun 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A
Keywords :  Porcine Pancreatic Elastase, Inhibitor, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Hofbauer, J. A. Brito, J. Mulchande, P. Nogly, M. Pessanha, R. Moreira, M. Archer
Crystal Structure Of Porcine Pancreatic Elastase (Ppe) In Complex With The Novel Inhibitor Jm102
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - CHYMOTRYPSIN-LIKE ELASTASE FAMILY MEMBER 1
    Chains: A
    EC Number: 3.4.21.36
    Organ: PANCREAS
    Organism Common: PIG
    Organism Scientific: SUS SCROFA
    Organism Taxid: 9823
    Synonym: ELASTASE-1

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 13)

Asymmetric/Biological Unit (5, 13)
No.NameCountTypeFull Name
14E41Ligand/Ion2-ETHYL-2-(HYDROXYMETHYL)-N-(6-METHYLPYRIDIN-3-YL)BUTANAMIDE
2ACT5Ligand/IonACETATE ION
3GOL1Ligand/IonGLYCEROL
4NA1Ligand/IonSODIUM ION
5SO45Ligand/IonSULFATE ION

(-) Sites  (13, 13)

Asymmetric Unit (13, 13)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:57 , THR A:96 , VAL A:99 , CYS A:191 , GLN A:192 , GLY A:193 , ASP A:194 , SER A:195 , SER A:214 , PHE A:215 , SO4 A:1004 , HOH A:1235 , HOH A:1242binding site for residue 4E4 A 1001
02AC2SOFTWARETYR A:137 , GLN A:156 , TYR A:207 , ACT A:1010binding site for residue SO4 A 1002
03AC3SOFTWAREALA A:126 , SER A:232 , ALA A:233 , TYR A:234 , ILE A:235 , SER A:236 , HOH A:1198binding site for residue SO4 A 1003
04AC4SOFTWAREPHE A:215 , VAL A:216 , 4E4 A:1001 , SO4 A:1005binding site for residue SO4 A 1004
05AC5SOFTWAREGLU A:62 , VAL A:99 , THR A:174 , SO4 A:1004binding site for residue SO4 A 1005
06AC6SOFTWARETHR A:146 , GLN A:192 , SER A:217 , ARG A:217A , GLY A:219 , CYS A:220 , HOH A:1193binding site for residue SO4 A 1006
07AC7SOFTWAREASN A:76 , ASP A:77 , GLY A:78 , TYR A:137 , TYR A:158binding site for residue ACT A 1007
08AC8SOFTWAREARG A:36 , THR A:64 , SER A:173 , THR A:174 , HOH A:1106binding site for residue ACT A 1008
09AC9SOFTWAREARG A:65A , TYR A:82 , VAL A:83binding site for residue ACT A 1009
10AD1SOFTWARESER A:26 , TYR A:207 , SO4 A:1002binding site for residue ACT A 1010
11AD2SOFTWAREGLN A:152 , THR A:153binding site for residue ACT A 1011
12AD3SOFTWAREGLU A:70 , ASN A:72 , GLN A:75 , GLU A:80 , HOH A:1233 , HOH A:1246binding site for residue NA A 1012
13AD4SOFTWARETRP A:38 , HIS A:40 , LEU A:73 , ASN A:74 , HOH A:1101binding site for residue GOL A 1013

(-) SS Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1A:42 -A:58
2A:136 -A:201
3A:167 -A:181
4A:191 -A:220

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4YM9)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4YM9)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4YM9)

(-) Exons   (0, 0)

(no "Exon" information available for 4YM9)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:240
                                                                                                                                                                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....ee........eeeeeeee..eeeeeeeeeeee..eeeehhhhhh....eeeee............eeeeeeeeee.......hhhhh...eeeee...........................eeeee..............eeee..eehhhhhh....hhhhh...eeee...............eeeeee..eeeeeeeeee............eeeee...hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                4ym9 A   16 VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN  245
                                    25        35 |||    42        52        62   |    71        81        91       99B       109       119       129       139       149       159       169||     177       187       197       207       217|    | 225       235       245
                                               36A||                           65A                                99A|                                                                   169A|                                             217A 221A                        
                                                36B|                                                               99B                                                                    169B                                                                              
                                                 36C
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4YM9)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4YM9)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4YM9)

(-) Gene Ontology  (23, 23)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    4E4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4ym9)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4ym9
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CELA1_PIG | P00772
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.36
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CELA1_PIG | P00772
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CELA1_PIG | P00772: 1b0e 1bma 1btu 1c1m 1e34 1e35 1e36 1e37 1e38 1eai 1eas 1eat 1eau 1ela 1elb 1elc 1eld 1ele 1elf 1elg 1esa 1esb 1est 1fle 1fzz 1gvk 1gwa 1h9l 1hax 1hay 1haz 1hb0 1hv7 1inc 1jim 1l0z 1l1g 1lka 1lkb 1lvy 1mcv 1mmj 1nes 1okx 1qgf 1qix 1qnj 1qr3 1uo6 1uvo 1uvp 2a7c 2a7j 2bb4 2bd2 2bd3 2bd4 2bd5 2bd7 2bd8 2bd9 2bda 2bdb 2bdc 2blo 2blq 2cv3 2d26 2de8 2de9 2est 2fo9 2foa 2fob 2foc 2fod 2foe 2fof 2fog 2foh 2g4t 2g4u 2h1u 2iot 2oqu 2v0b 2v35 3e3t 3est 3hgn 3hgp 3mnb 3mnc 3mns 3mnx 3mo3 3mo6 3mo9 3moc 3mty 3mu0 3mu1 3mu4 3mu5 3mu8 3odd 3odf 3uou 4est 4gvu 5avd 5est 6est 7est 8est 9est

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4YM9)