Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF FRUTALIN FROM ARTOCARPUS INCISA
 
Authors :  H. M. Pereira, A. C. O. M. Moreira, A. E. Vieira Neto, F. B. M. B. Moreno, M. D. P. Lobo, F. D. Sousa, T. B. Grangeiro, R. A. Moreira
Date :  15 Oct 14  (Deposition) - 28 Oct 15  (Release) - 28 Oct 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.81
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Alpha-D-Galactose-Binding Lectin, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. M. Pereira, A. C. O. M. Moreira, A. E. Vieira Neto, F. B. M. B. Moreno, M. D. P. Lobo, F. D. Sousa, T. B. Grangeiro, R. A. Moreira
Crystal Structure Of Frutalin From Artocarpus Incisa
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - FRUTALIN
    ChainsA, B, C, D
    Organism ScientificARTOCARPUS INCISA
    Organism Taxid3488

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4WOG)

(-) Sites  (0, 0)

(no "Site" information available for 4WOG)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4WOG)

(-) Cis Peptide Bonds  (12, 12)

Asymmetric/Biological Unit
No.Residues
1Gly A:13 -Pro A:14
2Phe A:84 -Pro A:85
3Gly A:118 -Pro A:119
4Gly B:13 -Pro B:14
5Phe B:84 -Pro B:85
6Gly B:118 -Pro B:119
7Gly C:13 -Pro C:14
8Phe C:84 -Pro C:85
9Gly C:118 -Pro C:119
10Gly D:13 -Pro D:14
11Phe D:84 -Pro D:85
12Gly D:118 -Pro D:119

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4WOG)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4WOG)

(-) Exons   (0, 0)

(no "Exon" information available for 4WOG)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:150
                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eeeeeee....eeee.....eeeeeeeee.....eeeeeeeeee..eeee...........eeeeee.......eeeeeeeeeee..eeeeeeeeeee...eeeeee....eeeeeeeee.eeeeeeeee...eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4wog A   3 QSGKSQTVIVGPWGAQVGKAFDDGAFTGIREINLSYNKETAIGDFQVIYDLNGSPFVGQNHTSFITGFTPVKISLDFPSEYIIEVSGHTGKVSGYVVVRSLAFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL 157
                                    12      ||27        37        47        57        67        77        87        97       107       117       127       137       147       157
                                           19|                                                                                                                                    
                                            25                                                                                                                                    

Chain B from PDB  Type:PROTEIN  Length:152
                                                                                                                                                                                        
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeee....eeee.....eeeeeeeee.....eeeeeeeeee..eeee...........eeeeee.......eeeeeeeeeee..eeeeeeeeeee...eeeeee....eeeeeeeee.eeeeeeeee...eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4wog B   1 AEQSGKSQTVIVGPWGAQVGKAFDDGAFTGIREINLSYNKETAIGDFQVIYDLNGSPFVGQNHTSFITGFTPVKISLDFPSEYIIEVSGHTGKVSGYVVVRSLAFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL 157
                                    10        25        35        45        55        65        75        85        95       105       115       125       135       145       155  
                                             19|                                                                                                                                    
                                              25                                                                                                                                    

Chain C from PDB  Type:PROTEIN  Length:150
                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eeeeeee....eeee.....eeeeeeeee.....eeeeeeeeee..eeee...........eeeeee.......eeeeeeeeeee..eeeeeeeeeee...eeeeee....eeeeeeeee.eeeeeeeee...eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4wog C   3 QSGKSQTVIVGPWGAQVGKAFDDGAFTGIREINLSYNKETAIGDFQVIYDLNGSPFVGQNHTSFITGFTPVKISLDFPSEYIIEVSGHTGKVSGYVVVRSLAFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL 157
                                    12      ||27        37        47        57        67        77        87        97       107       117       127       137       147       157
                                           19|                                                                                                                                    
                                            25                                                                                                                                    

Chain D from PDB  Type:PROTEIN  Length:150
                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eeeeeee....eeee.....eeeeeeeee.....eeeeeeeeee..eeee...........eeeeee.......eeeeeeeeeee..eeeeeeeeeee...eeeeee....eeeeeeeee.eeeeeeeee...eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4wog D   3 QSGKSQTVIVGPWGAQVGKAFDDGAFTGIREINLSYNKETAIGDFQVIYDLNGSPFVGQNHTSFITGFTPVKISLDFPSEYIIEVSGHTGKVSGYVVVRSLAFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL 157
                                    12      ||27        37        47        57        67        77        87        97       107       117       127       137       147       157
                                           19|                                                                                                                                    
                                            25                                                                                                                                    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4WOG)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4WOG)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4WOG)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 4WOG)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4wog)
 
  Sites
(no "Sites" information available for 4wog)
 
  Cis Peptide Bonds
    Gly A:118 - Pro A:119   [ RasMol ]  
    Gly A:13 - Pro A:14   [ RasMol ]  
    Gly B:118 - Pro B:119   [ RasMol ]  
    Gly B:13 - Pro B:14   [ RasMol ]  
    Gly C:118 - Pro C:119   [ RasMol ]  
    Gly C:13 - Pro C:14   [ RasMol ]  
    Gly D:118 - Pro D:119   [ RasMol ]  
    Gly D:13 - Pro D:14   [ RasMol ]  
    Phe A:84 - Pro A:85   [ RasMol ]  
    Phe B:84 - Pro B:85   [ RasMol ]  
    Phe C:84 - Pro C:85   [ RasMol ]  
    Phe D:84 - Pro D:85   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4wog
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A0A0R4I968_9 | A0A0R4I968
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  A0A0R4I968_9 | A0A0R4I968
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4WOG)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4WOG)