Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE DETERMINATION OF PSEUDOMONAS STUTZERI ENDOGLUCANASE CEL5A USING A TWINNED DATA SET
 
Authors :  R. Dutoit, M. Delsaute, R. Berlemont, D. Van Elder, M. Galleni, C. Bauv
Date :  29 Jul 13  (Deposition) - 30 Jul 14  (Release) - 30 Jul 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.56
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Glycosyl Hydrolase Family 5, Cellulase, Tim Barrel, Beta-1, 4- Endoglucanase, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Dutoit, M. Delsaute, R. Berlemont, D. Van Elder, M. Galleni, C. Bauvois
Structure Of The Pseudomonas Stutzeri Beta-1, 4 Endoglucanas Determined At 1. 6 A Resolution Using A Twinned Crystal.
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ENDOGLUCANASE(ENDO-1,4-BETA-GLUCANASE)PROTEIN
    Chains: A, B, C, D
    EC Number: 3.2.1.4
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: PST_2494
    Organism Scientific: PSEUDOMONAS STUTZERI
    Organism Taxid: 379731
    Strain: A1501

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A   
Biological Unit 2 (1x):  B  
Biological Unit 3 (1x):   C 
Biological Unit 4 (1x):    D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1TRS4Ligand/Ion2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1TRS1Ligand/Ion2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1TRS1Ligand/Ion2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
Biological Unit 3 (1, 1)
No.NameCountTypeFull Name
1TRS1Ligand/Ion2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
Biological Unit 4 (1, 1)
No.NameCountTypeFull Name
1TRS1Ligand/Ion2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:99 , TYR A:101 , ASN A:143 , GLU A:144 , GLU A:252 , HOH A:534 , HOH A:758BINDING SITE FOR RESIDUE TRS A 401
2AC2SOFTWAREHIS B:99 , TYR B:101 , ASN B:143 , GLU B:144 , GLU B:252 , TRP B:283 , HOH B:511 , HOH B:606BINDING SITE FOR RESIDUE TRS B 401
3AC3SOFTWAREHIS C:99 , TYR C:101 , ASN C:143 , GLU C:144 , TYR C:208 , GLU C:252 , TRP C:283 , HOH C:610 , HOH C:664 , HOH C:681BINDING SITE FOR RESIDUE TRS C 401
4AC4SOFTWAREHIS D:99 , TYR D:101 , ASN D:143 , GLU D:144 , GLU D:252 , HOH D:522 , HOH D:690 , HOH D:734BINDING SITE FOR RESIDUE TRS D 401

(-) SS Bonds  (4, 4)

Asymmetric Unit
No.Residues
1A:277 -A:318
2B:277 -B:318
3C:277 -C:318
4D:277 -D:318

(-) Cis Peptide Bonds  (16, 16)

Asymmetric Unit
No.Residues
1Ser A:19 -Gly A:20
2Thr A:28 -Pro A:29
3Trp A:283 -Ala A:284
4Gly A:322 -Pro A:323
5Ser B:19 -Gly B:20
6Thr B:28 -Pro B:29
7Trp B:283 -Ala B:284
8Gly B:322 -Pro B:323
9Ser C:19 -Gly C:20
10Thr C:28 -Pro C:29
11Trp C:283 -Ala C:284
12Gly C:322 -Pro C:323
13Ser D:19 -Gly D:20
14Thr D:28 -Pro D:29
15Trp D:283 -Ala D:284
16Gly D:322 -Pro D:323

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4LX4)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4LX4)

(-) Exons   (0, 0)

(no "Exon" information available for 4LX4)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:322
                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............eeeee.....................hhhhhhhhhhh...eeeeeehhhhhh.......hhhhhhhhhhhhhhhhhh..eeeeee....ee..ee......hhhhhhhhhhhhhhhhh....eeeee..........hhhhhhhhhhhhhhhhh...eeeee........hhhhhh...........eeeeee...........hhhhh.....hhhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhhhhhhhh...eeeeee..................hhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4lx4 A   2 DWPVNDEGGLALHGVNISGAGFAPHITPGKNGTHYFYPEKKHFKYYADQGIRLIRFPFIWERVQHSLDSGLNFDQIRLLKKTLDLAAQNGQKVILDMHNYGRYHGELIGSSKVPYEAYASVWRKLAERFKGHPGLLGYDIMNEPHSTVGLWPGAAQAAVDAIREVDDQTLIFIEGERWSSAYHWPLVNANFLINDPADRLIYEAHLYFDDDFSGKYMAQTSRNIDPMIGVERARPFIEWLQKHGQKGFLGEYGIPDDLPEAAQAMDNLLAYLNDNCVPSAYWAGGPGWGTYKLAIEPRNGKDRPQMELMRKHLANDCTAIGP 323
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321  


Chain B from PDB  Type:PROTEIN  Length:328
                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........eeeee.....................hhhhhhhhhhhh..eeeeeehhhhhh.......hhhhhhhhhhhhhhhhhh..eeeeee....ee..ee......hhhhhhhhhhhhhhhhh....eeeee..........hhhhhhhhhhhhhhhhh...eeeeehhhhhh..hhhhhh...........eeeeee...........hhhhhh....hhhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhhhhhhhhh..eeeeee..................hhhhhhhhhh................. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4lx4 B   3 WPVNDEGGLALHGVNISGAGFAPHITPGKNGTHYFYPEKKHFKYYADQGIRLIRFPFIWERVQHSLDSGLNFDQIRLLKKTLDLAAQNGQKVILDMHNYGRYHGELIGSSKVPYEAYASVWRKLAERFKGHPGLLGYDIMNEPHSTVGLWPGAAQAAVDAIREVDDQTLIFIEGERWSSAYHWPLVNANFLINDPADRLIYEAHLYFDDDFSGKYMAQTSRNIDPMIGVERARPFIEWLQKHGQKGFLGEYGIPDDLPEAAQAMDNLLAYLNDNCVPSAYWAGGPGWGTYKLAIEPRNGKDRPQMELMRKHLANDCTAIGPTPAQIAD 330
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322        


Chain C from PDB  Type:PROTEIN  Length:321
                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........eeeee.....................hhhhhhhhhhh...eeeeeehhhhhh.......hhhhhhhhhhhhhhhhhh..eeeeee....ee..ee......hhhhhhhhhhhhhhhhh....eeeee..........hhhhhhhhhhhhhhhhh...eeeee........hhhhhh...........eeeeee...........hhhhh.....hhhhhhhhhhhhhhhhhh..eeeeee.....hhhhhhhhhhhhhhhhhh...eeeeee................hhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4lx4 C   3 WPVNDEGGLALHGVNISGAGFAPHITPGKNGTHYFYPEKKHFKYYADQGIRLIRFPFIWERVQHSLDSGLNFDQIRLLKKTLDLAAQNGQKVILDMHNYGRYHGELIGSSKVPYEAYASVWRKLAERFKGHPGLLGYDIMNEPHSTVGLWPGAAQAAVDAIREVDDQTLIFIEGERWSSAYHWPLVNANFLINDPADRLIYEAHLYFDDDFSGKYMAQTSRNIDPMIGVERARPFIEWLQKHGQKGFLGEYGIPDDLPEAAQAMDNLLAYLNDNCVPSAYWAGGPGWGTYKLAIEPRKDRPQMELMRKHLANDCTAIGPTP 325
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292      |304       314       324 
                                                                                                                                                                                                                                                                                                                                  299|                       
                                                                                                                                                                                                                                                                                                                                   302                       


Chain D from PDB  Type:PROTEIN  Length:319
                                                                                                                                                                                                                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............eeeee.....................hhhhhhhhhhh...eeeeeehhhhhh.......hhhhhhhhhhhhhhhhhh..eeeeee....ee..ee......hhhhhhhhhhhhhhhhh....eeeee..........hhhhhhhhhhhhhhhhh...eeeee........hhhhhh...........eeeeee............hhhhh....hhhhhhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhhhhhhhhh...eeeeee..............hhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4lx4 D   2 DWPVNDEGGLALHGVNISGAGFAPHITPGKNGTHYFYPEKKHFKYYADQGIRLIRFPFIWERVQHSLDSGLNFDQIRLLKKTLDLAAQNGQKVILDMHNYGRYHGELIGSSKVPYEAYASVWRKLAERFKGHPGLLGYDIMNEPHSTVGLWPGAAQAAVDAIREVDDQTLIFIEGERWSSAYHWPLVNANFLINDPADRLIYEAHLYFDDDFSGKYMAQTSRNIDPMIGVERARPFIEWLQKHGQKGFLGEYGIPDDLPEAAQAMDNLLAYLNDNCVPSAYWAGGPGWGTYKLAIEPDRPQMELMRKHLANDCTAIGPT 324
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291      |305       315         
                                                                                                                                                                                                                                                                                                                                  298|                     
                                                                                                                                                                                                                                                                                                                                   303
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4LX4)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4LX4)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4LX4)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    TRS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:322 - Pro A:323   [ RasMol ]  
    Gly B:322 - Pro B:323   [ RasMol ]  
    Gly C:322 - Pro C:323   [ RasMol ]  
    Gly D:322 - Pro D:323   [ RasMol ]  
    Ser A:19 - Gly A:20   [ RasMol ]  
    Ser B:19 - Gly B:20   [ RasMol ]  
    Ser C:19 - Gly C:20   [ RasMol ]  
    Ser D:19 - Gly D:20   [ RasMol ]  
    Thr A:28 - Pro A:29   [ RasMol ]  
    Thr B:28 - Pro B:29   [ RasMol ]  
    Thr C:28 - Pro C:29   [ RasMol ]  
    Thr D:28 - Pro D:29   [ RasMol ]  
    Trp A:283 - Ala A:284   [ RasMol ]  
    Trp B:283 - Ala B:284   [ RasMol ]  
    Trp C:283 - Ala C:284   [ RasMol ]  
    Trp D:283 - Ala D:284   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4lx4
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A4VME5_PSEU5 | A4VME5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.2.1.4
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A4VME5_PSEU5 | A4VME5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4LX4)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4LX4)