Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  DROSOPHILA MUSCLE GLURIIB COMPLEX WITH GLUTAMATE
 
Authors :  P. Dharkar, M. L. Mayer
Date :  13 Nov 14  (Deposition) - 29 Apr 15  (Release) - 20 May 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Glutamate Receptor Ion Channel Ligand Binding Domain, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. H. Han, P. Dharkar, M. L. Mayer, M. Serpe
Functional Reconstitution Of Drosophila Melanogaster Nmj Glutamate Receptors.
Proc. Natl. Acad. Sci. Usa V. 112 6182 2015
PubMed-ID: 25918369  |  Reference-DOI: 10.1073/PNAS.1500458112

(-) Compounds

Molecule 1 - GLUTAMATE RECEPTOR IIB,GLUTAMATE RECEPTOR IIB
    Cell: MUSCLE
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET22 MODIFIED
    Expression System Strain: ORIGAMI B(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: GLURIIB, CG7234, DMEL_CG7234
    Organism Common: FRUIT FLY
    Organism Scientific: DROSOPHILA MELANOGASTER
    Organism Taxid: 7227

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1GLU2Mod. Amino AcidGLUTAMIC ACID
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1GLU1Mod. Amino AcidGLUTAMIC ACID
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1GLU1Mod. Amino AcidGLUTAMIC ACID

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:68 , ASP A:96 , THR A:98 , ARG A:103 , ILE A:145 , GLY A:148 , ALA A:149 , THR A:150 , GLU A:200 , HOH A:419 , HOH A:427 , HOH A:436binding site for residue GLU A 301
2AC2SOFTWARETYR B:68 , ASP B:96 , THR B:98 , ARG B:103 , GLY B:148 , ALA B:149 , THR B:150 , GLU B:200 , HOH B:420 , HOH B:429 , HOH B:445binding site for residue GLU B 301

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
1A:212 -A:268
2B:212 -B:268

(-) Cis Peptide Bonds  (5, 5)

Asymmetric Unit
No.Residues
1Lys A:19 -Pro A:20
2Lys A:173 -Pro A:174
3Lys B:19 -Pro B:20
4Ile B:128 -Gly B:129
5Lys B:173 -Pro B:174

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4WXJ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4WXJ)

(-) Exons   (0, 0)

(no "Exon" information available for 4WXJ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:253
                                                                                                                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.......ee.....hhhh.eehhhhhhhhhhhhhhh.eeeeee................hhhhhhhhh....ee......hhhhhh..eeeeeeeeeeeeeeee......hhhhhhh....eee....hhhhhhhhh..hhhhhhhhhhhhhh.......hhhhhhhhhhhhh..eeeeeehhhhhhhhh....eeeeeeeeeeeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4wxj A   9 IRYTVATRVGKPYFSWREEPYEGNERFEGYAVDLIYMLAQECKFDFNFEPVRDNKYGSYDANTDEWDGIIRQLIDNNAQIGICDLTITQARRSVVDFTVPFMQLGISILSYKGTDIGSLHDLVDQNKVQFGTIRGGATSVYFSESNDTDNRMAWNKMLSFKPDAFTKNNEEGVDRVKLSKGTYAFLMETTNLQYYVQRNCELTQIGESFGEKHYGIAVPLNADFRSNLSVGILRLSERGELFKLRNKWFNSCE 301
                                    18        28|       42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262|||
                                              28|                                                                                                                                                                                                                                   263||
                                               33                                                                                                                                                                                                                                    268|
                                                                                                                                                                                                                                                                                      301


Chain B from PDB  Type:PROTEIN  Length:255
                                                                                                                                                                                                                                                                                               
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee.......ee.....hhhh.eehhhhhhhhhhhhhhh.eeeeee........ee....eehhhhhhhhh....ee......hhhhhhhhee....eeeeeeeeee......hhhhhhh....eee....hhhhhhhhh..hhhhhhhhhhhhhh.......hhhhhhhhhhhhh..eeeeeehhhhhhhhh....eeeeeeeeeeeee..ee.....hhhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4wxj B   8 PIRYTVATRVGKPYFSWREEPYEGNERFEGYAVDLIYMLAQECKFDFNFEPVRDNKYGSYDANTDEWDGIIRQLIDNNAQIGICDLTITQARRSVVDFTVPFMQLGISILSYKGTDIGSLHDLVDQNKVQFGTIRGGATSVYFSESNDTDNRMAWNKMLSFKPDAFTKNNEEGVDRVKLSKGTYAFLMETTNLQYYVQRNCELTQIGESFGEKHYGIAVPLNADFRSNLSVGILRLSERGELFKLRNKWFNSCDE 301
                                    17        27||      41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261 ||||
                                               28|                                                                                                                                                                                                                                   263|||
                                                33                                                                                                                                                                                                                                    268||
                                                                                                                                                                                                                                                                                       269|
                                                                                                                                                                                                                                                                                        301
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4WXJ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4WXJ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4WXJ)

(-) Gene Ontology  (24, 24)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GLU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ile B:128 - Gly B:129   [ RasMol ]  
    Lys A:173 - Pro A:174   [ RasMol ]  
    Lys A:19 - Pro A:20   [ RasMol ]  
    Lys B:173 - Pro B:174   [ RasMol ]  
    Lys B:19 - Pro B:20   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4wxj
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9VMP3_DROME | Q9VMP3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9VMP3_DROME | Q9VMP3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4WXJ)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4WXJ)