Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF PENICILLIN BINDING PROTEIN FROM BACILLUS HALODURANS
 
Authors :  Z. Zhang, L. Satyanarayana, S. Chamala, B. Evans, R. Foti, A. Gizzi, B. H A. Kar, J. Lafleur, R. Seidel, G. Villigas, W. Zencheck, S. C. Almo, S. Swaminathan, New York Structural Genomics Research Consort (Nysgrc)
Date :  17 Aug 11  (Deposition) - 31 Aug 11  (Release) - 31 Aug 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Psi-Biology, New York Structural Genomics Research Consortium, Nysgrc, Penicillin Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Z. Zhang, L. Satyanarayana, S. C. Almo, S. Swaminathan
The Crystal Structure Of Penicillin Binding Protein From Bacillus Halodurans
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PENICILLIN-BINDING PROTEIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET
    Expression System StrainBL21 (DE3) RIP
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneBH2267
    Organism ScientificBACILLUS HALODURANS
    Organism Taxid272558
    StrainC-125

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3TG9)

(-) Sites  (0, 0)

(no "Site" information available for 3TG9)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3TG9)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Phe A:105 -Asp A:106

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3TG9)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3TG9)

(-) Exons   (0, 0)

(no "Exon" information available for 3TG9)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:322
 aligned with Q9KAM0_BACHD | Q9KAM0 from UniProtKB/TrEMBL  Length:332

    Alignment length:329
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320         
         Q9KAM0_BACHD     1 MKNHLHTIMEDWKLSGTALMKKGEDIPFIASLGFANRAERIPNEHHTRFGIASGCKLFTAIAICQLVEAGKLSFDTPLSDWLDAPFPNVTIHHLLTHTSGVPDYFDEEITDDFEDLWKDVPMYHLRRLKDFLPLFQHAPMKFPPGHRFHYNNAGFILLGLVVESVSGVTFQEYVEANVFQRAGMHESGYFAFDTLPAKTALGYIDLEDGSWKTNLYSLPVIGGSDGGAYVTAEDMMKLWLALMRHELLNETYTQKLLTPHVHCEDDDYYGYGVWIKQQDGAISKYHVMGYDPGVCFHSAFYPTSNGIVVVCANQSSGAYDVMAAIEALF 329
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh..eeeeeee.....eeeee.eee....ee......ee.hhhhhhhhhhhhhhhhhhh......hhhhh........hhhhhhh..........-------.hhhhh.hhhhh.hhhhhhhhh...............hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.......hhhhh.......eee.....eee...............eehhhhhhhhhhhhhh....hhhhhhhhh...eeee..eee....eeeee..eeeeeeeeeee..eeeeeeee....eeeeeee....hhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3tg9 A   1 MKNHLHTIMEDWKLSGTALMKKGEDIPFIASLGFANRAERIPNEHHTRFGIASGCKLFTAIAICQLVEAGKLSFDTPLSDWLDAPFPNVTIHHLLTHTSGVPDYFD-------EDLWKDVPMYHLRRLKDFLPLFQHAPMKFPPGHRFHYNNAGFILLGLVVESVSGVTFQEYVEANVFQRAGMHESGYFAFDTLPAKTALGYIDLEDGSWKTNLYSLPVIGGSDGGAYVTAEDMMKLWLALMRHELLNETYTQKLLTPHVHCEDDDYYGYGVWIKQQDGAISKYHVMGYDPGVCFHSAFYPTSNGIVVVCANQSSGAYDVMAAIEALF 329
                                    10        20        30        40        50        60        70        80        90       100     |   -   |   120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320         
                                                                                                                                   106     114                                                                                                                                                                                                                       

Chain B from PDB  Type:PROTEIN  Length:326
 aligned with Q9KAM0_BACHD | Q9KAM0 from UniProtKB/TrEMBL  Length:332

    Alignment length:326
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323      
         Q9KAM0_BACHD     4 HLHTIMEDWKLSGTALMKKGEDIPFIASLGFANRAERIPNEHHTRFGIASGCKLFTAIAICQLVEAGKLSFDTPLSDWLDAPFPNVTIHHLLTHTSGVPDYFDEEITDDFEDLWKDVPMYHLRRLKDFLPLFQHAPMKFPPGHRFHYNNAGFILLGLVVESVSGVTFQEYVEANVFQRAGMHESGYFAFDTLPAKTALGYIDLEDGSWKTNLYSLPVIGGSDGGAYVTAEDMMKLWLALMRHELLNETYTQKLLTPHVHCEDDDYYGYGVWIKQQDGAISKYHVMGYDPGVCFHSAFYPTSNGIVVVCANQSSGAYDVMAAIEALF 329
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh...eeeeeee.....eeeee.eee....ee......ee.hhhhhhhhhhhhhhhhhh.......hhhhh........hhhhhhh...............hhhhhhh..hhhhh.hhhhhhhhh................hhhhhhhhhhhhhhhh.hhhhhhhhhh............hhhhh.......eee.....eee...............eehhhhhhhhhhhhhh....hhhhhhhhh...eeee..eee....eeee....eeeeeeeeee..eeeeeeee....eeeeeee....hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3tg9 B   4 HLHTIMEDWKLSGTALMKKGEDIPFIASLGFANRAERIPNEHHTRFGIASGCKLFTAIAICQLVEAGKLSFDTPLSDWLDAPFPNVTIHHLLTHTSGVPDYFDEEITDDFEDLWKDVPMYHLRRLKDFLPLFQHAPMKFPPGHRFHYNNAGFILLGLVVESVSGVTFQEYVEANVFQRAGMHESGYFAFDTLPAKTALGYIDLEDGSWKTNLYSLPVIGGSDGGAYVTAEDMMKLWLALMRHELLNETYTQKLLTPHVHCEDDDYYGYGVWIKQQDGAISKYHVMGYDPGVCFHSAFYPTSNGIVVVCANQSSGAYDVMAAIEALF 329
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3TG9)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3TG9)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3TG9)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 3TG9)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3tg9)
 
  Sites
(no "Sites" information available for 3tg9)
 
  Cis Peptide Bonds
    Phe A:105 - Asp A:106   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3tg9
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9KAM0_BACHD | Q9KAM0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q9KAM0_BACHD | Q9KAM0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3TG9)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3TG9)