|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 6) Biological Unit 1 (2, 6) Biological Unit 2 (2, 3) Biological Unit 3 (2, 3) |
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 3NRL) |
(no "Cis Peptide Bond" information available for 3NRL) |
(no "SAP(SNP)/Variant" information available for 3NRL) |
(no "PROSITE Motif" information available for 3NRL) |
(no "Exon" information available for 3NRL) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:69 aligned with A7B1J1_RUMGN | A7B1J1 from UniProtKB/TrEMBL Length:73 Alignment length:69 14 24 34 44 54 64 A7B1J1_RUMGN 5 REGTLFYDTETGRYDIRFDLESFYGGLHCGECFDVKVKDVWVPVRIEMGDDWYLVGLNVSRLDGLRVRM 73 SCOP domains --------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------- Transcript 3nrl A 5 REGTLFYDTETGRYDIRFDLESFYGGLHCGECFDVKVKDVWVPVRIEmGDDWYLVGLNVSRLDGLRVRm 73 14 24 34 44 |54 64 | 52-MSE 73-MSE Chain B from PDB Type:PROTEIN Length:69 aligned with A7B1J1_RUMGN | A7B1J1 from UniProtKB/TrEMBL Length:73 Alignment length:69 14 24 34 44 54 64 A7B1J1_RUMGN 5 REGTLFYDTETGRYDIRFDLESFYGGLHCGECFDVKVKDVWVPVRIEMGDDWYLVGLNVSRLDGLRVRM 73 SCOP domains --------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------- Transcript 3nrl B 5 REGTLFYDTETGRYDIRFDLESFYGGLHCGECFDVKVKDVWVPVRIEmGDDWYLVGLNVSRLDGLRVRm 73 14 24 34 44 |54 64 | 52-MSE 73-MSE
|
(no "SCOP Domain" information available for 3NRL) |
(no "CATH Domain" information available for 3NRL) |
(no "Pfam Domain" information available for 3NRL) |
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3NRL)
|
|
|
|
|
|
|