Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  PUTATIVE NAD-DEPENDENT EPIMERASE/DEHYDRATASE FROM BACILLUS HALODURANS.
 
Authors :  J. Osipiuk, T. Skarina, O. Onopriyenko, A. Savchenko, A. M. Edwards, A. Joachimiak, Midwest Center For Structural Genomics (Mcsg)
Date :  20 Aug 08  (Deposition) - 02 Sep 08  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Structural Genomics, Apc7755, Nadp, Epimerase/Dehydratase, Psi-2, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Osipiuk, T. Skarina, O. Onopriyenko, A. Savchenko, A. M. Edwards, A. Joachimiak
X-Ray Crystal Structure Of Putative Nad-Dependent Epimerase/Dehydratase From Bacillus Halodurans.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PUTATIVE NAD-DEPENDENT EPIMERASE/DEHYDRATASE
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET15B MODIFIED
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: BH1520
    Organism Scientific: BACILLUS HALODURANS
    Organism Taxid: 86665
    Strain: C-125

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 7)

Asymmetric Unit (3, 7)
No.NameCountTypeFull Name
1CL1Ligand/IonCHLORIDE ION
2MSE5Mod. Amino AcidSELENOMETHIONINE
3NAP1Ligand/IonNADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
Biological Unit 1 (2, 12)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2MSE10Mod. Amino AcidSELENOMETHIONINE
3NAP2Ligand/IonNADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:9 , GLY A:10 , LYS A:11 , ARG A:32 , GLN A:36 , ASN A:52 , LEU A:53 , ALA A:71 , GLY A:72 , ILE A:85 , SER A:109 , SER A:110 , TYR A:126 , GLY A:150 , LEU A:152 , ARG A:176 , HOH A:534 , HOH A:551 , HOH A:630 , HOH A:631 , HOH A:632 , HOH A:633 , HOH A:634 , HOH A:635 , HOH A:636 , HOH A:638 , HOH A:650 , HOH A:652BINDING SITE FOR RESIDUE NAP A 500
2AC2SOFTWAREGLY A:112 , THR A:113 , ASP A:115 , HIS A:166 , HOH A:530 , HOH A:569 , HOH A:597BINDING SITE FOR RESIDUE CL A 501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3E8X)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3E8X)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3E8X)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3E8X)

(-) Exons   (0, 0)

(no "Exon" information available for 3E8X)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:214
 aligned with Q9KCP9_BACHD | Q9KCP9 from UniProtKB/TrEMBL  Length:213

    Alignment length:214
                             1                                                                                                                                                                                                                    
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209    
         Q9KCP9_BACHD     - -MRVLVVGANGKVARYLLSELKNKGHEPVAMVRNEEQGPELRERGASDIVVANLEEDFSHAFASIDAVVFAAGSGPHTGADKTILIDLWGAIKTIQEAEKRGIKRFIMVSSVGTVDPDQGPMNMRHYLVAKRLADDELKRSSLDYTIVRPGPLSNEESTGKVTVSPHFSEITRSITRHDVAKVIAELVDQQHTIGKTFEVLNGDTPIAKVVEQL 213
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3e8xA00 A:0-213 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                    CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...hhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhh...eeee......hhhhhh...eeee........hhhhhhhh.hhhhhhhhhhhhhhh..eeeee......hhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeee..ee......eeeee.........eehhhhhhhhhhhh.hhhhh.eeeeeeeeeeehhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3e8x A   0 GmRVLVVGANGKVARYLLSELKNKGHEPVAmVRNEEQGPELRERGASDIVVANLEEDFSHAFASIDAVVFAAGSGPHTGADKTILIDLWGAIKTIQEAEKRGIKRFImVSSVGTVDPDQGPmNmRHYLVAKRLADDELKRSSLDYTIVRPGPLSNEESTGKVTVSPHFSEITRSITRHDVAKVIAELVDQQHTIGKTFEVLNGDTPIAKVVEQL 213
                             |       9        19        29|       39        49        59        69        79        89        99       109       119 | |   129       139       149       159       169       179       189       199       209    
                             |                           30-MSE                                                                      107-MSE       121-MSE                                                                                        
                             1-MSE                                                                                                                   123-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3E8X)

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3E8X)

(-) Gene Ontology  (1, 1)

Asymmetric Unit(hide GO term definitions)
Chain A   (Q9KCP9_BACHD | Q9KCP9)
molecular function
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3e8x)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3e8x
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9KCP9_BACHD | Q9KCP9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9KCP9_BACHD | Q9KCP9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3E8X)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3E8X)