Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF Q88YI3_LACPL FROM LACTOBACILLUS PLANTARUM. NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET LPR6
 
Authors :  J. Benach, Y. Chen, J. Seetharaman, K. H. Chi, H. Janjua, K. Cunningham, L. C. Ma, R. Xiao, J. Liu, M. C. Baran, T. B. Acton, B. Rost, G. T. Montelione, L. Tong, J. F. Hunt, Northeast Structural Genomics Consortium (Nesg)
Date :  01 Mar 07  (Deposition) - 27 Mar 07  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym./Biol. Unit :  A
Keywords :  Lpr6, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Benach, Y. Chen, J. Seetharaman, K. H. Chi, H. Janjua, K. Cunningham, L. C. Ma, R. Xiao, J. Liu, M. C. Baran, T. B. Acton, B. Rost, G. T. Montelione, L. Tong, J. F. Hunt
Crystal Structure Of Q88Yi3_lacpl From Lactobacillus Plantarum.
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN LP_0780
    Atcc: BAA-793
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET21
    Expression System Strain: BL21(DE3)+MAGIC
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: LP_0780
    Organism Scientific: LACTOBACILLUS PLANTARUM
    Organism Taxid: 1590
    Strain: NCIMB 8826, WCFS1

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 7)

Asymmetric/Biological Unit (1, 7)
No.NameCountTypeFull Name
1MSE7Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2P0Y)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2P0Y)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Gly A:195 -Pro A:196

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2P0Y)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2P0Y)

(-) Exons   (0, 0)

(no "Exon" information available for 2P0Y)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:240
 aligned with F9UM03_LACPL | F9UM03 from UniProtKB/TrEMBL  Length:333

    Alignment length:324
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329    
         F9UM03_LACPL    10 RPKIVVIGGGTGLPVVLNGLRKQAVDITAVVTVADDGGSSGIIRNYVNVVPPGDIRNVMVALSSWPDLYKDIFQYRFQGDDQFFAGHAIGNLIIAALTEMKSGVFDAVQELSNMMQVDGHVYPAANEALTLHGKFSDGTELVGEAEITAAHKSLERVWVTDKNGKEPQAVQPVIDAIMAADQIVLGPGSLFTSILPNLTIGNIGRAVCESDAEVVYICNIMTQKGETDNFSDADHVRVLNRHLGQNFINTVLVNTEKVPEDYMDFHKFNEVSKQVSHDFRGLREQNCRVISSNFLKLRDNGAFHDGDQVVAELMNLVGHSDVFR 333
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeee.hhhhhhhhhhhhhhh..eeeee..----------------------hhhhhhhhh...hhhhhhh.---------------....---------hhhhhhhhhhhhh....eee.----..eeee......-----------......eeee------...hhhhhhhhhhh.eeee........hhhhhhhhhhhhhhhhh..eeeee.....--......hhhhhhhhhhhh.----..eeeee....hhhhhhhh-----......hhhhhhh...eeeee.....------..hhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2p0y A  10 RPKIVVIGGGTGLPVVLNGLRKQAVDITAVVT----------------------IRNVmVALSSWPDLYKDIFQ---------------GNLI---------GVFDAVQELSNmmQVDGHVYP----ALTLHGKFSDGT-----------HKSLERVWVT------PQAVQPVIDAImAADQIVLGPGSLFTSILPNLTIGNIGRAVCESDAEVVYICNImT--GETDNFSDADHVRVLNRHL----INTVLVNTEKVPEDYmDFH-----SKQVSHDFRGLREQNCRVISSNFLKL------HDGDQVVAELmNLVGHSDVFR 333
                                    19        29        39 |       -         -    |   69        79   |     -        99  |      -  |    119   ||  129  |    139        |-         -|      169      |179       189       199       209       219       229||  |  239       249  |    259       269  |  |   - |     289       299      |  -   |   319   |   329    
                                                          41                     64   |             83              99  |       112        123-MSE  132  137        148         160      169    176        187-MSE                                    230-MSE               252  257            272-MSE  281                      306    313       323-MSE      
                                                                                     68-MSE                           102                   124-MSE                                                                                                    231  |                                      275                                                          
                                                                                                                                                                                                                                                          234
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2P0Y)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2P0Y)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2P0Y)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (F9UM03_LACPL | F9UM03)
biological process
    GO:0008360    regulation of cell shape    Any process that modulates the surface configuration of a cell.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2p0y)
 
  Cis Peptide Bonds
    Gly A:195 - Pro A:196   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2p0y
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  F9UM03_LACPL | F9UM03
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  F9UM03_LACPL | F9UM03
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2P0Y)

(-) Related Entries Specified in the PDB File

lpr6