|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (2, 2)
NMR Structure
|
||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2MVI) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2MVI) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2MVI) |
Exons (0, 0)| (no "Exon" information available for 2MVI) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:43 aligned with PASM1_LACPN | C7G1H4 from UniProtKB/Swiss-Prot Length:64 Alignment length:43 31 41 51 61 PASM1_LACPN 22 KPAWCWYTLAMCGAGYDSGTCDYMYSHCFGVKHSSGGGGSYHC 64 SCOP domains ------------------------------------------- SCOP domains CATH domains ------------------------------------------- CATH domains Pfam domains ------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------- PROSITE Transcript ------------------------------------------- Transcript 2mvi A 1 KPAWCWYTLAMCGAGYDSGTCDYMYSHCFGVKHSSGGGGSYHC 43 10 20 30 40
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2MVI) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2MVI) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2MVI) |
Gene Ontology (4, 4)|
NMR Structure(hide GO term definitions) Chain A (PASM1_LACPN | C7G1H4)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|