Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION NMR STRUCTURE OF FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT FROM LACTOBACILLUS PLANTARUM, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET LPR145J
 
Authors :  G. Liu, Y. Tang, R. Xiao, H. Janjua, C. Ciccosanti, H. Wang, T. Acton, J. K G. T. Montelione, Northeast Structural Genomics Consortium (Ne
Date :  29 Jun 11  (Deposition) - 17 Aug 11  (Release) - 22 Feb 12  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Structural Genomics, Northeast Structural Genomics Consortium (Nesg), Psi-Biology, Protein Structure Initiative, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. Liu, Y. Tang, R. Xiao, H. Janjua, C. T. Ciccosanti, H. Wang, T. Acton, J. K. Everett, G. T. Montelione
Northeast Structural Genomics Consortium Target Lpr145J
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - FUMARATE REDUCTASE, FLAVOPROTEIN SUBUNIT
    Chains: A
    EC Number: 1.3.99.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector: PET 21-23C
    Fragment: SEQUENCE DATABASE RESIDUES 348-498
    Gene: LP_3491
    Organism Scientific: LACTOBACILLUS PLANTARUM
    Organism Taxid: 1590

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2LFC)

(-) Sites  (0, 0)

(no "Site" information available for 2LFC)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2LFC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2LFC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2LFC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2LFC)

(-) Exons   (0, 0)

(no "Exon" information available for 2LFC)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:160
 aligned with F9UUF7_LACPL | F9UUF7 from UniProtKB/TrEMBL  Length:763

    Alignment length:176
                                   356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516      
         F9UUF7_LACPL   347 EVEPGVAKLTTYASKQATDMGAIYVNSKGDRIVNESNVYTTFRNAILKQADKVAYLVMDERTWKKVYDLLILHDFTPEEIKSFFENKGKRPVFVKGSLESAAEQAGIVVDELVQTVKNYQGYVQDGHDHDFGRDPKYLHQFEGETFYIIEQRDRFATTLGGYSVDADNLQLVTTKN 522
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhhhhh.eee.....eee....hhhhhhhhhhhh....eeeeeehhhhhhhhhhhhhhh.hhhhhhhh.........ee..hhhhhhhhhh.hhhhhhhhhhhhhhhhh.....................eeeeee.----------------........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2lfc A   1 MVEPGVAKLTTYASKQATDMGAIYVNSKGDRIVNESNVYTTFRNAILKQADKVAYLVMDERTWKKVYDLLILHDFTPEEIKSFFENKGKRPVFVKGSLESAAEQAGIVVDELVQTVKNYQGYVQDGHDHDFGRDPKYLHQFEGETFYIIEQR----------------LEHHHHHH 160
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150 |       -       154      
                                                                                                                                                                                 152              153
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2LFC)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2LFC)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2LFC)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (F9UUF7_LACPL | F9UUF7)
molecular function
    GO:0010181    FMN binding    Interacting selectively and non-covalently with flavin mono nucleotide. Flavin mono nucleotide (FMN) is the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0000104    succinate dehydrogenase activity    Catalysis of the reaction: succinate + acceptor = fumarate + reduced acceptor.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2lfc)
 
  Sites
(no "Sites" information available for 2lfc)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2lfc)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2lfc
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  F9UUF7_LACPL | F9UUF7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.3.99.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  F9UUF7_LACPL | F9UUF7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2LFC)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2LFC)