Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Theoretical Model
collapse expand < >
Image Theoretical Model
Theoretical Model  (Jmol Viewer)

(-) Description

Title :  THEORTICAL MODEL OF PHAC1 PROTEIN OF INDIGENOUS PSEUDOMONAS SP.LDC-25
 
Authors :  K. Sujatha, A. Mahalakshmi, R. Shenbagarathai
Date :  17 Aug 06  (Deposition) - 19 Oct 06  (Release) - 19 Oct 06  (Revision)
Method :  THEORETICAL MODEL
Resolution :  NOT APPLICABLE
Chains :  Theor. Model :  A
Keywords :  Pseudomonas Sp. Ldc-25, Phac1 Gene, Pha Synthase, Pha Accumulating Pseudomonas Strains, Homology Modeling (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. Sujatha, A. Mahalakshmi, R. Shenbagarathai
Theortical Model Of Phac1 Protein Of Indigenous Pseudomonas Sp. Ldc-25
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PHA SYNTHASE OF LDC 25
    Chains: A
    EC Number: 5.3.1.16
    Fragment: PHA SYNTHASE
    Organism Common: PSEUDOMONAS
    Organism Scientific: PSEUDOMONAS SP.LDC 25
    Other Details: MADURAI COLLECTION OF PHA ACCUMULATING PSEUDOMONAS STRAINS.
    Strain: LDC 25
    Variant: FIELD ISOLATE

 Structural Features

(-) Chains, Units

  
Theoretical Model : 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2J2N)

(-) Sites  (0, 0)

(no "Site" information available for 2J2N)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2J2N)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2J2N)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2J2N)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2J2N)

(-) Exons   (0, 0)

(no "Exon" information available for 2J2N)

(-) Sequences/Alignments

Theoretical Model
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:267
                                                                                                                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhh......................hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhh.....ee...........hhhhhhhh.....hhhhhh.........hhhhhh.....hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhh.............hhhhhh...eeeee.......hhhhhhhhhh....eeeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2j2n A  52 RRAVARLPRGDVVGGAGTYVRRLAHPIQAQREWGLSTYIDALKEAVDAVLAITGSKDLNMLGACSGGITCTALVGHYAAVGENKVNALTLLVSVLDTTLDTQVALFVDEQTLEAAKRHSYQAGVLEGSEMAKVFAWMRPNDLIWNYLVNNYLLGNEPPCSTSCSGTRHHAPASRVHGDLIEMFKTNPLTRPGALEVCGTPIDLKQVQCDIFSVLEVCGTPIDLKQVQCDIFSVAGTADHITPWQSCYRSAHLFGGKIEFVLSNSGHI 318
                                    61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2J2N)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2J2N)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2J2N)

(-) Gene Ontology  (0, 0)

Theoretical Model(hide GO term definitions)
    (no "Gene Ontology" information available for 2J2N)

 Visualization

(-) Interactive Views

Theoretical Model
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2j2n)
 
  Sites
(no "Sites" information available for 2j2n)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2j2n)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Theoretical Model PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2j2n
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProt
 
Access by Enzyme Classificator   (EC Number)
  5.3.1.16
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2J2N)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2J2N)