|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 6)| Asymmetric Unit (2, 6) Biological Unit 1 (2, 12) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2B1Y) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2B1Y) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2B1Y) |
Exons (0, 0)| (no "Exon" information available for 2B1Y) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:101 aligned with A9CIG4_AGRFC | A9CIG4 from UniProtKB/TrEMBL Length:104 Alignment length:101 13 23 33 43 53 63 73 83 93 103 A9CIG4_AGRFC 4 PNFRYTHYDLKELRAGTTLEISLSSVNNVRLMTGANFQRFTELLDFKYLGGVAKKSPIRIAVPETMHWHLIIDAEGHSGLAESSVKMLPAQPQATLTRKAS 104 SCOP domains d2b1ya1 A:4-104 Hypothetical protein Atu1913 SCOP domains CATH domains ----------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------- Transcript 2b1y A 4 PNFRYTHYDLKELRAGTTLEISLSSVNNVRLmTGANFQRFTELLDFKYLGGVAKKSPIRIAVPETmHWHLIIDAEGHSGLAESSVKmLPAQPQATLTRKAS 104 13 23 33 | 43 53 63 | 73 83 | 93 103 35-MSE 69-MSE 90-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2B1Y) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2B1Y) |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2B1Y)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|