|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1E8P) |
Sites (0, 0)| (no "Site" information available for 1E8P) |
SS Bonds (2, 2)
NMR Structure
|
||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1E8P) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1E8P) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1E8P) |
Exons (0, 0)| (no "Exon" information available for 1E8P) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:46 aligned with Q9P868_PIREQ | Q9P868 from UniProtKB/TrEMBL Length:410 Alignment length:46 29 39 49 59 Q9P868_PIREQ 20 AACWAQSQGYNCCNNPSSTKVEYTDASGQWGVQNGQWCGIDYSYGQ 65 SCOP domains d1e8pa_ A: Cellulose docking domain, dockering SCOP domains CATH domains 1e8pA00 A:1-46 CATH domains Pfam domains ---------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------- PROSITE Transcript ---------------------------------------------- Transcript 1e8p A 1 ASCWAQSQGYNCCNNPSSTKVEYTDASGQWGVQNGQWCGIDYSYGQ 46 10 20 30 40
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1E8P) |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (Q9P868_PIREQ | Q9P868)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|