Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains d4f2na1 A:22-117 automated matches                                                              d4f2na2 A:118-230 automated matches                                                                               SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............................hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4F2N A  22 CYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221         

Chain B from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains d4f2nb1 B:21-117 automated matches                                                               d4f2nb2 B:118-230 automated matches                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....................hhhhh.....hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4F2N B  21 LCYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230

Chain C from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains d4f2nc1 C:22-117 automated matches                                                              d4f2nc2 C:118-230 automated matches                                                                               SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...................hhhhh.....hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4F2N C  22 CYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221         

Chain D from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains d4f2nd1 D:21-117 automated matches                                                               d4f2nd2 D:118-230 automated matches                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....................hhhhh.....hhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4F2N D  21 LCYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230

Chain E from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains d4f2ne1 E:22-117 automated matches                                                              d4f2ne2 E:118-230 automated matches                                                                               SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............................hhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4F2N E  22 CYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221         

Chain F from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains d4f2nf1 F:21-117 automated matches                                                               d4f2nf2 F:118-230 automated matches                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....................hhhhh.....hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4F2N F  21 LCYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230

Chain G from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains d4f2ng1 G:22-117 automated matches                                                              d4f2ng2 G:118-230 automated matches                                                                               SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............................hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4F2N G  22 CYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221         

Chain H from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains d4f2nh1 H:21-117 automated matches                                                               d4f2nh2 H:118-230 automated matches                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....................hhhhh.....hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4F2N H  21 LCYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230

Chain I from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains d4f2ni1 I:22-117 automated matches                                                              d4f2ni2 I:118-230 automated matches                                                                               SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...................hhhhh.....hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4F2N I  22 CYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221         

Chain J from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains d4f2nj1 J:21-117 automated matches                                                               d4f2nj2 J:118-230 automated matches                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....................hhhhh.....hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4F2N J  21 LCYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230

Chain K from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains d4f2nk1 K:22-117 automated matches                                                              d4f2nk2 K:118-230 automated matches                                                                               SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...................hhhhh.....hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee....eeeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4F2N K  22 CYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221         

Chain L from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains d4f2nl1 L:22-117 automated matches                                                              d4f2nl2 L:118-230 automated matches                                                                               SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...................hhhhh.....hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee......eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4F2N L  22 CYHTLPHLRYPAELPTLGFNYKDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDWEFVCHMYERATK 230
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'