Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:333
 aligned with KAPCA_HUMAN | P17612 from UniProtKB/Swiss-Prot  Length:351

    Alignment length:337
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       
          KAPCA_HUMAN    15 SVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF 351
               SCOP domains d3pooa_ A: automated matches                                                                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh......hhh.eeeeeeeeee..eeeeeeee.....eeeeeeeehhhhhhh.hhhhhhhhhhhhh.........eeeeee...eeeeeee.....hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee..........hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh........hhhhhhhhhhhh..............hhhhhhhhhhh..hhhhhhh...........----............................ Sec.struct. author
                 SAPs(SNPs) --------------------------V----Q---------------------------------------------------------------------------------------------------------------------------------------------------------------R---------------------------------------------------------C--------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------PROTEIN_KINASE_ATP      -----------------------------------------------------------------------------------------PROTEIN_KINAS---------------------------------------------------------------------------------------------------------------------------AGC_KINASE_CTER  PDB: A:298-350 UniProt: 299-351      PROSITE
           Transcript 1 (1) 1.--------------------Exon 1.4  PDB: A:36-78 UniProt: 37-79      Exon 1.5  PDB: A:79-111          Exon 1.6  PDB: A:112-139    ------------------------------------------Exon 1.8  PDB: A:182-213        Exon 1.9  PDB: A:214-254 UniProt: 215-255Exon 1.10  PDB: A:255-309 UniProt: 256-310             Exon 1.11  PDB: A:310-350 (gaps)          Transcript 1 (1)
           Transcript 1 (2) -Exon 1.3  PDB: A:15-3-------------------------------------------------------------------------------------------------------Exon 1.7  PDB: A:139-181 UniProt: 140-182  ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3POO A  14 SVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWtLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKF----DTSNFDDYEEEEIRVsINEKCGKEFSEF 350
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193   |   203       213       223       233       243       253       263       273       283       293       303       313    |  323       333    |  343       
                                                                                                                                                                                                                 197-TPO                                                                                                                  318  323            338-SEP        

Chain B from PDB  Type:PROTEIN  Length:19
 aligned with IPKA_HUMAN | P61925 from UniProtKB/Swiss-Prot  Length:76

    Alignment length:19
                                    15         
           IPKA_HUMAN     6 TTYADFIASGRTGRRNAIH  24
               SCOP domains ------------------- SCOP domains
               CATH domains ------------------- CATH domains
               Pfam domains ------------------- Pfam domains
         Sec.struct. author hhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ------------------- SAPs(SNPs)
                    PROSITE ------------------- PROSITE
               Transcript 2 Exon 2.4            Transcript 2
                 3POO B   5 TTYADFIASGRTGRRNAIH  23
                                    14         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'