Reformat:	Number of residues per line =  ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete  aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:113
 aligned with TZAP_HUMAN | P10074 from UniProtKB/Swiss-Prot  Length:688

    Alignment length:113
                                    12        22        32        42        52        62        72        82        92       102       112   
           TZAP_HUMAN     3 GSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSGGSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAARELRVPEAVELCQSFK 115
               SCOP domains d3b84a_ A: automated matches                                                                                      SCOP domains
               CATH domains 3b84A00 A:3-115 Potassium Channel Kv1.1; Chain A                                                                  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhh....eeeee..eeeeehhhhhhhhhhhhhhhhh......eeehhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh.hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------BTB  PDB: A:26-89 UniProt: 26-89                                -------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: A:3-115 UniProt: 1-230 [INCOMPLETE]                                                                Transcript 1
                 3B84 A   3 MSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSGGSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAARELRVPEAVELCQSFK 115
                                    12        22        32        42        52        62        72        82        92       102       112   

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'