Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:212
 aligned with COMT_RAT | P22734 from UniProtKB/Swiss-Prot  Length:264

    Alignment length:212
                                    55        65        75        85        95       105       115       125
             COMT_RAT    46 DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQP 125
               SCOP domains d2zlba_ A: automated matches                                                     SCOP domains
               CATH domains 2zlbA00 A:3-214 Vaccinia Virus protein VP39                                      CATH domains
               Pfam domains ----------------Methyltransf_3-2zlbA01 A:19-181                                  Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: A:3-47 UniProt: 1-90          ----------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------Exon 1.3  PDB: A:47-111 UniProt: 90- Transcript 1 (2)
                 2ZLB A   3 DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQP  82
                                    12        22        32        42        52        62        72        82

                                   135       145       155       165       175       185       195       205
             COMT_RAT   126 GARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRK 205
               SCOP domains                                                                                  SCOP domains
               CATH domains                                                                                  CATH domains
               Pfam domains                                                                                  Pfam domains
         Sec.struct. author ..eeeee..hhhhhhhhhhhhhhh.hhh.eeee..hhhhhh.hhhhhh....eeeeee..hhhhhhhhhhhhhhh..eee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) -----------------------------Exon 1.4  PDB: A:112-155 UniProt: 155-198   Exon 1. Transcript 1 (1)
           Transcript 1 (2) 154                          --------------------------------------------------- Transcript 1 (2)
                 2ZLB A  83 GARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRK 162
                                    92       102       112       122       132       142       152       162

                                   215       225       235       245       255    
             COMT_RAT   206 GTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQG 257
               SCOP domains                                                      SCOP domains
               CATH domains                                                      CATH domains
               Pfam domains                    --------------------------------- Pfam domains
         Sec.struct. author eeeeee.......hhhhhhhhhhh..eeeeeeee........eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------- PROSITE
           Transcript 1 (1) 5  PDB: A:156-214 UniProt: 199-264 [INCOMPLETE]      Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------- Transcript 1 (2)
                 2ZLB A 163 GTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQG 214
                                   172       182       192       202       212    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'