Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:44
 aligned with ZN268_HUMAN | Q14587 from UniProtKB/Swiss-Prot  Length:947

    Alignment length:90
                                   482       492       502       512       522       532       542       552       562
          ZN268_HUMAN   473 GCIQCGKGFSLKSQLIVHQRSHTGMKPYVCNECGKAFRSKSYLIIHTRTHTGEKLHECNNCGKAFSFKSQLIIHQRIHTGENPYECHECG 562
               SCOP domains ----------------------d2en7a1 A:8-35              ---------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .--....-------------..................hhhhhhhhhh.....-------------------------..--.----... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -ZINC_FINGER_C2H2_1   -------ZINC_FINGER_C2H2_1   -------ZINC_FINGER_C2H2_1   -------ZINC_ PROSITE
               Transcript 1 Exon 1.14b  PDB: A:1-44 (gaps) UniProt: 153-947 [INCOMPLETE]                               Transcript 1
                 2EN7 A   1 G--SSGS-------------SGTGMKPYVCNECGKAFRSKSYLIIHTRTHTGE-------------------------SG--P----SSG  44
                            |  |  |  -         -|       15        25        35  |      -         -        40  |    |44
                            |  2  5             6                              38                        39| 41   42  
                            1                                                                             40
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'