Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:345
 aligned with LIVJ_ECO57 | P0AD98 from UniProtKB/Swiss-Prot  Length:367

    Alignment length:345
                                                                                                                                                                                                                                                                                                                                                                                 367 
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363   | 
           LIVJ_ECO57    24 EDIKVAVVGAMSGPVAQYGDQEFTGAEQAVADINAKGGIKGNKLQIVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYQLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGEGLARAVQDGLKKGNANVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDDPAEIAKYLKANSVDTVMGPLTWDEKGDLKGFEFGVFDWHANGTATDAK-   -
               SCOP domains d1z16a_ A: automated matches                                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1z16A01 A:1-120,A:250-328  [code=3.40.50.2300, no name defined]                                                         1z16A02 A:121-249,A:329-344  [code=3.40.50.2300, no name defined]                                                                1z16A01 A:1-120,A:250-328  [code=3.40.50.2300, no name defined]                1z16A02         - CATH domains
               Pfam domains -Peripla_BP_6-1z16A01 A:2-338                                                                                                                                                                                                                                                                                                                     ------- Pfam domains
         Sec.struct. author ..eeeeeee.....hhhhhhhhhhhhhhhhhhhhhh.......eeeeeee...hhhhhhhhhhhhhhh...eee...hhhhhhhhhhhhhhhh.eeee....hhhhhh.....eee...hhhhhhhhhhhhhhhh.....eeeee..hhhhhhhhhhhhhhhhhh...eeeeee.......hhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhh....eeeehhhhhhhhhhhhhhhhhh.eeeee..hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh.eee..eee.............eeeee.....eee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1Z16 A   1 EDIKVAVVGAMSGPVAQYGDQEFTGAEQAVADINAKGGIKGNKLQIVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYQLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGEGLARAVQDGLKKGNANVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDDPAEIAKYLKANSVDTVMGPLTWDEKGDLKGFEFGVFDWHANGTATDAKL 400
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340   ||
                                                                                                                                                                                                                                                                                                                                                                                 344|
                                                                                                                                                                                                                                                                                                                                                                                  400

Chain A from PDB  Type:PROTEIN  Length:345
 aligned with LIVJ_ECOL6 | P0AD97 from UniProtKB/Swiss-Prot  Length:367

    Alignment length:345
                                                                                                                                                                                                                                                                                                                                                                                 367 
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363   | 
           LIVJ_ECOL6    24 EDIKVAVVGAMSGPVAQYGDQEFTGAEQAVADINAKGGIKGNKLQIVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYQLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGEGLARAVQDGLKKGNANVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDDPAEIAKYLKANSVDTVMGPLTWDEKGDLKGFEFGVFDWHANGTATDAK-   -
               SCOP domains d1z16a_ A: automated matches                                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1z16A01 A:1-120,A:250-328  [code=3.40.50.2300, no name defined]                                                         1z16A02 A:121-249,A:329-344  [code=3.40.50.2300, no name defined]                                                                1z16A01 A:1-120,A:250-328  [code=3.40.50.2300, no name defined]                1z16A02         - CATH domains
               Pfam domains -Peripla_BP_6-1z16A01 A:2-338                                                                                                                                                                                                                                                                                                                     ------- Pfam domains
         Sec.struct. author ..eeeeeee.....hhhhhhhhhhhhhhhhhhhhhh.......eeeeeee...hhhhhhhhhhhhhhh...eee...hhhhhhhhhhhhhhhh.eeee....hhhhhh.....eee...hhhhhhhhhhhhhhhh.....eeeee..hhhhhhhhhhhhhhhhhh...eeeeee.......hhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhh....eeeehhhhhhhhhhhhhhhhhh.eeeee..hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh.eee..eee.............eeeee.....eee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1Z16 A   1 EDIKVAVVGAMSGPVAQYGDQEFTGAEQAVADINAKGGIKGNKLQIVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYQLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGEGLARAVQDGLKKGNANVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDDPAEIAKYLKANSVDTVMGPLTWDEKGDLKGFEFGVFDWHANGTATDAKL 400
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340   ||
                                                                                                                                                                                                                                                                                                                                                                                 344|
                                                                                                                                                                                                                                                                                                                                                                                  400

Chain A from PDB  Type:PROTEIN  Length:345
 aligned with LIVJ_ECOLI | P0AD96 from UniProtKB/Swiss-Prot  Length:367

    Alignment length:345
                                                                                                                                                                                                                                                                                                                                                                                 367 
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363   | 
           LIVJ_ECOLI    24 EDIKVAVVGAMSGPVAQYGDQEFTGAEQAVADINAKGGIKGNKLQIVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYQLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGEGLARAVQDGLKKGNANVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDDPAEIAKYLKANSVDTVMGPLTWDEKGDLKGFEFGVFDWHANGTATDAK-   -
               SCOP domains d1z16a_ A: automated matches                                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1z16A01 A:1-120,A:250-328  [code=3.40.50.2300, no name defined]                                                         1z16A02 A:121-249,A:329-344  [code=3.40.50.2300, no name defined]                                                                1z16A01 A:1-120,A:250-328  [code=3.40.50.2300, no name defined]                1z16A02         - CATH domains
               Pfam domains -Peripla_BP_6-1z16A01 A:2-338                                                                                                                                                                                                                                                                                                                     ------- Pfam domains
         Sec.struct. author ..eeeeeee.....hhhhhhhhhhhhhhhhhhhhhh.......eeeeeee...hhhhhhhhhhhhhhh...eee...hhhhhhhhhhhhhhhh.eeee....hhhhhh.....eee...hhhhhhhhhhhhhhhh.....eeeee..hhhhhhhhhhhhhhhhhh...eeeeee.......hhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhh....eeeehhhhhhhhhhhhhhhhhh.eeeee..hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh.eee..eee.............eeeee.....eee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1Z16 A   1 EDIKVAVVGAMSGPVAQYGDQEFTGAEQAVADINAKGGIKGNKLQIVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYQLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGEGLARAVQDGLKKGNANVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDDPAEIAKYLKANSVDTVMGPLTWDEKGDLKGFEFGVFDWHANGTATDAKL 400
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340   ||
                                                                                                                                                                                                                                                                                                                                                                                 344|
                                                                                                                                                                                                                                                                                                                                                                                  400

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'