Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:90
 aligned with GLHA_HUMAN | P01215 from UniProtKB/Swiss-Prot  Length:116

    Alignment length:90
                                    36        46        56        66        76        86        96       106       116
           GLHA_HUMAN    27 DVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS 116
               SCOP domains d1xwda_ A: Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha)           SCOP domains
               CATH domains 1xwdA00 A:3-92 Cystine-knot cytokines                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ........eeee...........eeeeeeeeeeeee.hhhhhh.......eeeee.eeeeeeeeeeee...eeeeeeeeeeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ----GLYCO_HORMONE_ALPHA_3  PDB: A:7-92 UniProt: 31-116                                     PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) -------------------------GLYCO_HORMONE-------------------------------------GLYCO_HORMONE_- PROSITE (3)
           Transcript 2 (1) 2.2 -------------------------------------------------------------Exon 2.4  PDB: A:68-92    Transcript 2 (1)
           Transcript 2 (2) ---Exon 2.3  PDB: A:6-67 UniProt: 30-91                          ------------------------- Transcript 2 (2)
                 1XWD A   3 DVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS  92
                                    12        22        32        42        52        62        72        82        92

Chain B from PDB  Type:PROTEIN  Length:105
 aligned with FSHB_HUMAN | P01225 from UniProtKB/Swiss-Prot  Length:129

    Alignment length:105
                                    30        40        50        60        70        80        90       100       110       120     
           FSHB_HUMAN    21 CELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFG 125
               SCOP domains d1xwdb1 B:3-107 Follicle stimulating hormone, follitropin, beta chain                                     SCOP domains
               CATH domains 1xwdB00 B:3-107 Cystine-knot cytokines                                                                    CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeeee....eeeeeeeeeeeeeeeee..............eeeeeeeeeeeeee........eeeeeeeeeeeeee......eeee............ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------G-------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------GLYCO_H------------------------------------------GLYCO_HORMONE_BETA_2        --- PROSITE (2)
               Transcript 1 Exon 1.2b  PDB: B:3-35           Exon 1.3b  PDB: B:36-107 UniProt: 54-129 [INCOMPLETE]                    Transcript 1
                 1XWD B   3 CELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFG 107
                                    12        22        32        42        52        62        72        82        92       102     

Chain C from PDB  Type:PROTEIN  Length:242
 aligned with FSHR_HUMAN | P23945 from UniProtKB/Swiss-Prot  Length:695

    Alignment length:242
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257  
           FSHR_HUMAN    18 CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLE 259
               SCOP domains d1xwdc1 C:18-259 Follicle-stimulating hormone receptor                                                                                                                                                                                             SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee...eeeee................eeeee.....ee............eeeee......ee....ee......eeeee......ee....ee......eeeee..................eeeeee......ee............eeee.......ee.........eeeee......................eee..................eee...ee......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------Y-------------------------------T----------------------------V----------------------------------V----------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1XWD C  18 CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLE 259
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257  

Chain D from PDB  Type:PROTEIN  Length:87
 aligned with GLHA_HUMAN | P01215 from UniProtKB/Swiss-Prot  Length:116

    Alignment length:87
                                    39        49        59        69        79        89        99       109       
           GLHA_HUMAN    30 DCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS 116
               SCOP domains d1xwdd_ D: Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha)        SCOP domains
               CATH domains 1xwdD00 D:6-92 Cystine-knot cytokines                                                   CATH domains
           Pfam domains (1) Hormone_6-1xwdD01 D:6-92                                                                Pfam domains (1)
           Pfam domains (2) Hormone_6-1xwdD02 D:6-92                                                                Pfam domains (2)
         Sec.struct. author .....eeee...........eeeeeeeeeeeee...hhhhh......eeeee.eeeeeeeeeee.....eeeeeeeeeee....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -GLYCO_HORMONE_ALPHA_3  PDB: D:7-92 UniProt: 31-116                                     PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------GLYCO_HORMONE-------------------------------------GLYCO_HORMONE_- PROSITE (3)
           Transcript 2 (1) 2-------------------------------------------------------------Exon 2.4  PDB: D:68-92    Transcript 2 (1)
           Transcript 2 (2) Exon 2.3  PDB: D:6-67 UniProt: 30-91                          ------------------------- Transcript 2 (2)
                 1XWD D   6 DCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS  92
                                    15        25        35        45        55        65        75        85       

Chain E from PDB  Type:PROTEIN  Length:105
 aligned with FSHB_HUMAN | P01225 from UniProtKB/Swiss-Prot  Length:129

    Alignment length:105
                                    30        40        50        60        70        80        90       100       110       120     
           FSHB_HUMAN    21 CELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFG 125
               SCOP domains d1xwde_ E: Follicle stimulating hormone, follitropin, beta chain                                          SCOP domains
               CATH domains 1xwdE00 E:3-107 Cystine-knot cytokines                                                                    CATH domains
           Pfam domains (1) Cys_knot-1xwdE01 E:3-104                                                                              --- Pfam domains (1)
           Pfam domains (2) Cys_knot-1xwdE02 E:3-104                                                                              --- Pfam domains (2)
         Sec.struct. author .eeeeeeeeee.hhhh.eeeeeeeeeeeeeeee..............eeeeeeeeeeeeee........eeeeeeeeeeeeee......eeee............ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------G-------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------GLYCO_H------------------------------------------GLYCO_HORMONE_BETA_2        --- PROSITE (2)
               Transcript 1 Exon 1.2b  PDB: E:3-35           Exon 1.3b  PDB: E:36-107 UniProt: 54-129 [INCOMPLETE]                    Transcript 1
                 1XWD E   3 CELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFG 107
                                    12        22        32        42        52        62        72        82        92       102     

Chain F from PDB  Type:PROTEIN  Length:233
 aligned with FSHR_HUMAN | P23945 from UniProtKB/Swiss-Prot  Length:695

    Alignment length:233
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247   
           FSHR_HUMAN    18 CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTY 250
               SCOP domains d1xwdf_ F: Follicle-stimulating hormone receptor                                                                                                                                                                                          SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) LRRNT-1xwdF05 F:18-45       ---------------------------------------------------------------------------------------------------------------------------------------------------LRR_8-1xwdF01 F:193-246                               ---- Pfam domains (1)
           Pfam domains (2) LRRNT-1xwdF06 F:18-45       ---------------------------------------------------------------------------------------------------------------------------------------------------LRR_8-1xwdF02 F:193-246                               ---- Pfam domains (2)
           Pfam domains (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_8-1xwdF03 F:193-246                               ---- Pfam domains (3)
           Pfam domains (4) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_8-1xwdF04 F:193-246                               ---- Pfam domains (4)
         Sec.struct. author ......ee...eeeee................eeeee.....ee............eeeee......ee....ee......eeeeeee....ee....ee......eeeeeee................eeeeee......ee...........eeeee.......ee........eeeeee......................eee..................eee..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------Y-------------------------------T----------------------------V----------------------------------V-------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1XWD F  18 CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTY 250
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'