Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:232
 aligned with NMNA1_HUMAN | Q9HAN9 from UniProtKB/Swiss-Prot  Length:279

    Alignment length:270
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275
          NMNA1_HUMAN     6 KTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTA 275
               SCOP domains d1kqna_ A: Nicotinamide mononucleotide (NMN) adenylyltransferase                                                                                                                                                                                                               SCOP domains
               CATH domains 1kqnA00 A:6-275 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeeeee.....hhhhhhhhhhhhhhhhhh..eeeeeeeeee.hhhhh.....hhhhhhhhhhhhh.....eee..hhhhh....hhhhhhhhhhhhhh.--------------------------------------...eeeeeeehhhhhhh......hhhhhhhhhhhh.eeeee.hhhhhhhhhhhhhhhhhh...eeeee.......hhhhhhhhhhh........hhhhhhhhhhhh..hhhhhh......hhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) ---M---T------N------------G-T------------------V-----------WF-V--H-------------------------G------------------------------------------------P---F-P--R----------------G----M--C--M----------------------W---------N-------------------C-S-----------P-----K---------------D-- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------------------------------------------------------V-----------------------------------------------------------------------------------L-------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: A:6-39            ------------------------------------------------------------Exon 1.4a  PDB: A:100-147 (gaps)                -------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------Exon 1.3  PDB: A:39-100 UniProt: 39-100                       ----------------------------------------------Exon 1.6b  PDB: A:147-275 UniProt: 147-279 [INCOMPLETE]                                                                           Transcript 1 (2)
                 1KQN A   6 KTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEA--------------------------------------AVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTA 275
                                    15        25        35        45        55        65        75        85        95       105  |      -         -         -         - |     155       165       175       185       195       205       215       225       235       245       255       265       275
                                                                                                                                108                                    147                                                                                                                                

Chain B from PDB  Type:PROTEIN  Length:231
 aligned with NMNA1_HUMAN | Q9HAN9 from UniProtKB/Swiss-Prot  Length:279

    Alignment length:270
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275
          NMNA1_HUMAN     6 KTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTA 275
               SCOP domains d1kqnb_ B: Nicotinamide mononucleotide (NMN) adenylyltransferase                                                                                                                                                                                                               SCOP domains
               CATH domains 1kqnB00 B:6-275 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeeeee.....hhhhhhhhhhhhhhhhhh..eeeeeeeeee.hhhhh.....hhhhhhhhhhhhhh....eee.hhhhhh....hhhhhhhhhhhhhh.---------------------------------------..eeeeeeehhhhhhh......hhhhhhhhhhhh.eeeee.hhhhhhhhhhhhhhhhhh...eeeee.......hhhhhhhhhhh........hhhhhhhhhhhh..hhhhhhh.....hhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) ---M---T------N------------G-T------------------V-----------WF-V--H-------------------------G----------------------------------------------------F-P--R----------------G----M--C--M----------------------W---------N-------------------C-S-----------P-----K---------------D-- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------------------------------------------------------V-----------------------------------------------------------------------------------L-------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: B:6-39            ------------------------------------------------------------Exon 1.4a  PDB: B:100-108 UniProt: 100-147      -------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------Exon 1.3  PDB: B:39-100 UniProt: 39-100                       ----------------------------------------------Exon 1.6b  PDB: B:148-275 UniProt: 147-279 [INCOMPLETE]                                                                           Transcript 1 (2)
                 1KQN B   6 KTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEA---------------------------------------VPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTA 275
                                    15        25        35        45        55        65        75        85        95       105  |      -         -         -         -  |    155       165       175       185       195       205       215       225       235       245       255       265       275
                                                                                                                                108                                     148                                                                                                                               

Chain C from PDB  Type:PROTEIN  Length:231
 aligned with NMNA1_HUMAN | Q9HAN9 from UniProtKB/Swiss-Prot  Length:279

    Alignment length:270
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275
          NMNA1_HUMAN     6 KTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTA 275
               SCOP domains d1kqnc_ C: Nicotinamide mononucleotide (NMN) adenylyltransferase                                                                                                                                                                                                               SCOP domains
               CATH domains 1kqnC00 C:6-275 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeeeee.....hhhhhhhhhhhhhhhhhh..eeeeeeeeee.hhhhh.....hhhhhhhhhhhhh.....eee..hhhhh....hhhhhhhhhhhhhh.---------------------------------------..eeeeeeehhhhhhhhh....hhhhhhhhhhhh.eeeee.hhhhhhhhhhhhhhhhhh...eeeee.......hhhhhhhhhhh........hhhhhhhhhhhh..hhhhhh......hhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) ---M---T------N------------G-T------------------V-----------WF-V--H-------------------------G----------------------------------------------------F-P--R----------------G----M--C--M----------------------W---------N-------------------C-S-----------P-----K---------------D-- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------------------------------------------------------V-----------------------------------------------------------------------------------L-------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: C:6-39            ------------------------------------------------------------Exon 1.4a  PDB: C:100-108 UniProt: 100-147      -------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------Exon 1.3  PDB: C:39-100 UniProt: 39-100                       ----------------------------------------------Exon 1.6b  PDB: C:148-275 UniProt: 147-279 [INCOMPLETE]                                                                           Transcript 1 (2)
                 1KQN C   6 KTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEA---------------------------------------VPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTA 275
                                    15        25        35        45        55        65        75        85        95       105  |      -         -         -         -  |    155       165       175       185       195       205       215       225       235       245       255       265       275
                                                                                                                                108                                     148                                                                                                                               

Chain D from PDB  Type:PROTEIN  Length:231
 aligned with NMNA1_HUMAN | Q9HAN9 from UniProtKB/Swiss-Prot  Length:279

    Alignment length:270
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275
          NMNA1_HUMAN     6 KTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTA 275
               SCOP domains d1kqnd_ D: Nicotinamide mononucleotide (NMN) adenylyltransferase                                                                                                                                                                                                               SCOP domains
               CATH domains 1kqnD00 D:6-275 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeeeee.....hhhhhhhhhhhhhhhhhh..eeeeeeeeee.hhhhh.....hhhhhhhhhhhhhh....eee.hhhhhh....hhhhhhhhhhhhhh.---------------------------------------..eeeeeeehhhhhhhhh....hhhhhhhhhhhh.eeeee.hhhhhhhhhhhhhhhhhh...eeeee.......hhhhhhhhhhh........hhhhhhhhhhh...hhhhhhh.....hhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) ---M---T------N------------G-T------------------V-----------WF-V--H-------------------------G----------------------------------------------------F-P--R----------------G----M--C--M----------------------W---------N-------------------C-S-----------P-----K---------------D-- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------------------------------------------------------V-----------------------------------------------------------------------------------L-------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: D:6-39            ------------------------------------------------------------Exon 1.4a  PDB: D:100-108 UniProt: 100-147      -------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------Exon 1.3  PDB: D:39-100 UniProt: 39-100                       ----------------------------------------------Exon 1.6b  PDB: D:148-275 UniProt: 147-279 [INCOMPLETE]                                                                           Transcript 1 (2)
                 1KQN D   6 KTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEA---------------------------------------VPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTA 275
                                    15        25        35        45        55        65        75        85        95       105  |      -         -         -         -  |    155       165       175       185       195       205       215       225       235       245       255       265       275
                                                                                                                                108                                     148                                                                                                                               

Chain E from PDB  Type:PROTEIN  Length:232
 aligned with NMNA1_HUMAN | Q9HAN9 from UniProtKB/Swiss-Prot  Length:279

    Alignment length:270
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275
          NMNA1_HUMAN     6 KTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTA 275
               SCOP domains d1kqne_ E: Nicotinamide mononucleotide (NMN) adenylyltransferase                                                                                                                                                                                                               SCOP domains
               CATH domains 1kqnE00 E:6-275 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeeeee.....hhhhhhhhhhhhhhhhhh..eeeeeeeeee.hhhhh.....hhhhhhhhhhhhhh....eee.hhhhhh....hhhhhhhhhhhhhh.--------------------------------------...eeeeeeehhhhhhhhh....hhhhhhhhhhhh.eeeee.hhhhhhhhhhhhhhhhhh...eeeee.......hhhhhhhhhhh........hhhhhhhhhhhh..hhhhhhh.....hhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) ---M---T------N------------G-T------------------V-----------WF-V--H-------------------------G------------------------------------------------P---F-P--R----------------G----M--C--M----------------------W---------N-------------------C-S-----------P-----K---------------D-- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------------------------------------------------------V-----------------------------------------------------------------------------------L-------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: E:6-39            ------------------------------------------------------------Exon 1.4a  PDB: E:100-147 (gaps)                -------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------Exon 1.3  PDB: E:39-100 UniProt: 39-100                       ----------------------------------------------Exon 1.6b  PDB: E:147-275 UniProt: 147-279 [INCOMPLETE]                                                                           Transcript 1 (2)
                 1KQN E   6 KTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEA--------------------------------------AVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTA 275
                                    15        25        35        45        55        65        75        85        95       105  |      -         -         -         - |     155       165       175       185       195       205       215       225       235       245       255       265       275
                                                                                                                                108                                    147                                                                                                                                

Chain F from PDB  Type:PROTEIN  Length:231
 aligned with NMNA1_HUMAN | Q9HAN9 from UniProtKB/Swiss-Prot  Length:279

    Alignment length:270
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275
          NMNA1_HUMAN     6 KTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTA 275
               SCOP domains d1kqnf_ F: Nicotinamide mononucleotide (NMN) adenylyltransferase                                                                                                                                                                                                               SCOP domains
               CATH domains 1kqnF00 F:6-275 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                                                          CATH domains
           Pfam domains (1) ------CTP_transf_2-1kqnF01 F:12-229                                                                                                                                                                                             ---------------------------------------------- Pfam domains (1)
           Pfam domains (2) ------CTP_transf_2-1kqnF02 F:12-229                                                                                                                                                                                             ---------------------------------------------- Pfam domains (2)
           Pfam domains (3) ------CTP_transf_2-1kqnF03 F:12-229                                                                                                                                                                                             ---------------------------------------------- Pfam domains (3)
           Pfam domains (4) ------CTP_transf_2-1kqnF04 F:12-229                                                                                                                                                                                             ---------------------------------------------- Pfam domains (4)
           Pfam domains (5) ------CTP_transf_2-1kqnF05 F:12-229                                                                                                                                                                                             ---------------------------------------------- Pfam domains (5)
           Pfam domains (6) ------CTP_transf_2-1kqnF06 F:12-229                                                                                                                                                                                             ---------------------------------------------- Pfam domains (6)
         Sec.struct. author .eeeeeeeee.....hhhhhhhhhhhhhhhhhhh.eeeeeeeeee.hhhhh.....hhhhhhhhhhhhhh....eee...........hhhhhhhhhhhhhh.---------------------------------------..eeeeeeehhhhhhhhh....hhhhhhhhhhhh.eeeee.hhhhhhhhhhhhhhhhhh...eeeee.......hhhhhhhhhhh........hhhhhhhhhhhh..hhhhhh......hhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) ---M---T------N------------G-T------------------V-----------WF-V--H-------------------------G----------------------------------------------------F-P--R----------------G----M--C--M----------------------W---------N-------------------C-S-----------P-----K---------------D-- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------------------------------------------------------V-----------------------------------------------------------------------------------L-------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: F:6-39            ------------------------------------------------------------Exon 1.4a  PDB: F:100-108 UniProt: 100-147      -------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------Exon 1.3  PDB: F:39-100 UniProt: 39-100                       ----------------------------------------------Exon 1.6b  PDB: F:148-275 UniProt: 147-279 [INCOMPLETE]                                                                           Transcript 1 (2)
                 1KQN F   6 KTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEA---------------------------------------VPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTA 275
                                    15        25        35        45        55        65        75        85        95       105  |      -         -         -         -  |    155       165       175       185       195       205       215       225       235       245       255       265       275
                                                                                                                                108                                     148                                                                                                                               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'