Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  X-RAY STRUCTURE REFINEMENT AND COMPARISON OF THREE FORMS OF MITOCHONDRIAL ASPARTATE AMINOTRANSFERASE
 
Authors :  C. A. Mcphalen, M. G. Vincent, J. N. Jansonius
Date :  02 Dec 91  (Deposition) - 31 Oct 93  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Transferase(Aminotransferase) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. A. Mcphalen, M. G. Vincent, J. N. Jansonius
X-Ray Structure Refinement And Comparison Of Three Forms Of Mitochondrial Aspartate Aminotransferase.
J. Mol. Biol. V. 225 495 1992
PubMed-ID: 1593633  |  Reference-DOI: 10.1016/0022-2836(92)90935-D
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ASPARTATE AMINOTRANSFERASE
    Chains: A, B
    EC Number: 2.6.1.1
    Engineered: YES
    Expression System: UNIDENTIFIED
    Expression System Taxid: 32644
    Organ: HEART
    Organism Common: CHICKEN
    Organism Scientific: GALLUS GALLUS
    Organism Taxid: 9031

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1PMP2Ligand/Ion4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:107 , GLY A:108 , THR A:109 , LEU A:112 , TRP A:140 , ASN A:194 , ASP A:222 , ALA A:224 , TYR A:225 , SER A:255 , LYS A:258 , ARG A:266 , TYR B:70 , HOH B:642BINDING SITE FOR RESIDUE PMP A 411
2AC2SOFTWARETYR A:70 , HOH A:622 , SER B:107 , GLY B:108 , THR B:109 , LEU B:112 , TRP B:140 , ASN B:194 , ASP B:222 , TYR B:225 , SER B:255 , ALA B:257 , LYS B:258 , ARG B:266 , HOH B:429BINDING SITE FOR RESIDUE PMP B 411
3ACAAUTHORASP A:15 , ILE A:17 , LEU A:18 , VAL A:37 , GLY A:38 , ALA A:39 , TYR A:70 , SER A:107 , GLY A:108 , THR A:109 , TRP A:140 , ASN A:194 , ASP A:222 , ALA A:224 , TYR A:225 , SER A:255 , LYS A:258 , ARG A:266 , ARG A:292 , SER A:296 , ASN A:297 , PHE A:360 , ARG A:386ACTIVE SITE, COMPRISES THE COFACTOR BINDING SITE AND CATALYTIC SITE
4ACBAUTHORASP B:15 , ILE B:17 , LEU B:18 , VAL B:37 , GLY B:38 , ALA B:39 , TYR B:70 , SER B:107 , GLY B:108 , THR B:109 , TRP B:140 , ASN B:194 , ASP B:222 , ALA B:224 , TYR B:225 , SER B:255 , LYS B:258 , ARG B:266 , ARG B:292 , SER B:296 , ASN B:297 , PHE B:360 , ARG B:386ACTIVE SITE, COMPRISES THE COFACTOR BINDING SITE AND CATALYTIC SITE

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 9AAT)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Lys A:137 -Pro A:138
2Asn A:194 -Pro A:195
3Lys B:137 -Pro B:138
4Asn B:194 -Pro B:195

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 9AAT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 9AAT)

(-) Exons   (0, 0)

(no "Exon" information available for 9AAT)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:401
                                                                                                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains d9aata_ A: Aspartate aminotransferase, AAT                                                                                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains ------------9aatA01 A:15-48,A:328-409         9aatA02 A:49-327 Type I PLP-dependent aspartate aminotransferase-like (Major domain)                                                                                                                                                                                             9aatA01 A:15-48,A:328-409 Aspartate Aminotransferase, domain 1                   - CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhhhhhhhh......eee...............hhhhhhhhhhhh.............hhhhhhhhhhhh....hhhhh.eeeeeee..hhhhhhhhhhhhhhh....eeeeeee....hhhhhhhhh..eeeee...........hhhhhhhhhh....eeeeeee...........hhhhhhhhhhhhhh..eeeeee.............hhhhhhhhhh...eeeeee............eeeeeee..hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhh...eeeee...hhhhhhhhhhheee....eeeee......hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 9aat A   3 SSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFIEQGIDVVLSQSYAKNMGLYGERAGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVASSNVGYLAHAIHQVTK 410
                                    12        22        32        42        52        62 ||     73        83        93       103       113       123  |||| 137       147    || 158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       409 
                                                                                        64|                                                         126|||                152|                                                                                                                                                                                                                                                         406|  
                                                                                         66                                                          129||                 154                                                                                                                                                                                                                                                          408  
                                                                                                                                                      130|                                                                                                                                                                                                                                                                                   
                                                                                                                                                       133                                                                                                                                                                                                                                                                                   


Chain B from PDB  Type:PROTEIN  Length:401
                                                                                                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains d9aatb_ B: Aspartate aminotransferase, AAT                                                                                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains ------------9aatB01 B:15-48,B:328-409         9aatB02 B:49-327 Type I PLP-dependent aspartate aminotransferase-like (Major domain)                                                                                                                                                                                             9aatB01 B:15-48,B:328-409 Aspartate Aminotransferase, domain 1                   - CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhhhhhhhh......eee...............hhhhhhhhhhhh.............hhhhhhhhhhhh..........eeeeeee..hhhhhhhhhhhhhhh....eeeeeee....hhhhhhhhh..eeeee...........hhhhhhhhhh....eeeeeee...........hhhhhhhhhhhhhh..eeeeee.............hhhhhhhhhh...eeeeee............eeeeeee..hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhh...eeeee...hhhhhhhhhhheee....eeeee......hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 9aat B   3 SSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFIEQGIDVVLSQSYAKNMGLYGERAGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVASSNVGYLAHAIHQVTK 410
                                    12        22        32        42        52        62 ||     73        83        93       103       113       123  |||| 137       147    || 158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       409 
                                                                                        64|                                                         126|||                152|                                                                                                                                                                                                                                                         406|  
                                                                                         66                                                          129||                 154                                                                                                                                                                                                                                                          408  
                                                                                                                                                      130|                                                                                                                                                                                                                                                                                   
                                                                                                                                                       133
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 9AAT)

(-) Gene Ontology  (18, 18)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PMP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    ACA  [ RasMol ]  +environment [ RasMol ]
    ACB  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:194 - Pro A:195   [ RasMol ]  
    Asn B:194 - Pro B:195   [ RasMol ]  
    Lys A:137 - Pro A:138   [ RasMol ]  
    Lys B:137 - Pro B:138   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)
Insightii
  ribbon, secondary structure, PMP, active site
[ mono GIF format | stereo GIF format ]
  PMP, active site, labeling
[ mono GIF format | stereo GIF format ]
  chain A: ribbon; chain B: spacefill
[ mono GIF format | stereo GIF format ]
Distance Plot
  representative atom: CA
[ mono GIF format | mono PDF format ]

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  9aat
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AATM_CHICK | P00508
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.6.1.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  AATM_CHICK | P00508
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        AATM_CHICK | P00508: 1aka 1akb 1akc 1ama 1ivr 1map 1maq 1oxo 1oxp 1tar 1tas 1tat 7aat 8aat

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 9AAT)