9INS - JenaLib

Asym.Unit - manually

Asymmetric Unit

Biological Unit 1

Biological Unit 2

collapse

expand

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Description

Title :   MONOVALENT CATION BINDING IN CUBIC INSULIN CRYSTALS

Authors :   J. Badger, G. G. Dodson

Date :   23 Oct 91 (Deposition) - 07 Nov 91 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.70

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: A,B  (2x)

Keywords :   Hormone (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   O. Gursky, Y. Li, J. Badger, D. L. D. Caspar
Monovalent Cation Binding To Cubic Insulin Crystals
Biophys. J. V. 61 604 1992
PubMed-ID: 1504238
(for further references see the PDB file header)

Compounds

Molecule 1 - INSULIN (CHAIN A)
	Chains	:	A
	Engineered	:	YES
	Organism Common	:	PIG
	Organism Scientific	:	SUS SCROFA
	Organism Taxid	:	9823

Molecule 2 - INSULIN (CHAIN B)
	Chains	:	B
	Engineered	:	YES
	Organism Common	:	PIG
	Organism Scientific	:	SUS SCROFA
	Organism Taxid	:	9823

Structural Features

Chains, Units

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (2x)	:	A	B

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 9INS)

Sites (0, 0)

(no "Site" information available for 9INS)

SS Bonds (3, 3)

Asymmetric Unit

No.	Residues
1	A:6	-	A:11
2	A:7	-	B:7
3	A:20	-	B:19

Cis Peptide Bonds (0, 0)

(no "Cis Peptide Bond" information available for 9INS)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

(no "SAP(SNP)/Variant" information available for 9INS)

PROSITE Motifs (0, 0)

(no "PROSITE Motif" information available for 9INS)

Exons (0, 0)

(no "Exon" information available for 9INS)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:21
                                                    
               SCOP domains d9ins.1 B:,A: Insulin SCOP domains
               CATH domains --------------------- CATH domains
               Pfam domains --------------------- Pfam domains
         Sec.struct. author hhhhhhhhhh.hhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------- SAPs(SNPs)
                    PROSITE --------------------- PROSITE
                 Transcript --------------------- Transcript
                  9ins A  1 GIVEQCCTSICSLYQLENYCN 21
                                    10        20

Chain B from PDB  Type:PROTEIN  Length:30
                                                             
               SCOP domains d9ins.1 B:,A: Insulin          SCOP domains
               CATH domains ------------------------------ CATH domains
               Pfam domains ------------------------------ Pfam domains
         Sec.struct. author ........hhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------ PROSITE
                 Transcript ------------------------------ Transcript
                  9ins B  1 FVNQHLCGSHLVEALYLVCGERGFFYTPKA 30
                                    10        20        30

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Small proteins (3458)

Fold: Insulin-like (117)

Superfamily: Insulin-like (117)

Family: Insulin-like (117)

Protein domain: Insulin (92)

Pig (Sus scrofa) [TaxId: 9823] (26)

d9ins.1

B:,A:

CATH Domains (0, 0)

(no "CATH Domain" information available for 9INS)

Pfam Domains (0, 0)

(no "Pfam Domain" information available for 9INS)

Gene Ontology (18, 18)

Asymmetric Unit(hide GO term definitions)

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 9ins)

	Sites
(no "Sites" information available for 9ins)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 9ins)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	9ins
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	INS_PIG \| P01315
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	INS_PIG \| P01315
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
	INS_PIG \| P01315	:	1b17 1b18 1b19 1b2a 1b2b 1b2c 1b2d 1b2e 1b2f 1b2g 1dei 1iza 1izb 1m5a 1mpj 1sdb 1wav 1zei 1zni 2efa 2g4m 2tci 2zpp 3fhp 3gky 3ins 3mth 3rto 3t2a 4a7e 4ins 5d52 5d53 5d54 5d5e 5fb6 5lis 6ins 7ins

Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 9INS)